Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.300 2.8e-02
intraductal papillary-mucinous neoplasm ... -2.500 3.2e-04
malignant mesothelioma -1.100 3.5e-05
medulloblastoma, large-cell -1.500 8.0e-05
osteosarcoma -1.506 2.2e-04
ovarian cancer -1.200 1.1e-05
psoriasis -1.300 7.7e-11

Gene RIF (1)

AA Sequence

MRLKMTTRNFPEREVPCDVEVERFTREVPCLSSLGDGWDCENQEGHLRQSALTLEKPGTQEAICEYPGFG      1 - 70
EHLIASSDLPPSQRVLATNGFHAPDSNVSGLDCDPALPSYPKSYADKRTGDSDACGKGFNHSMEVIHGRN     71 - 140
PVREKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKNFENIFTLSSSLNENQRNLPGEKQYRCTECGK    141 - 210
CFKRNSSLVLHHRTHTGEKPYTCNECGKSFSKNYNLIVHQRIHTGEKPYECSKCGKAFSDGSALTQHQRI    211 - 280
HTGEKPYECLECGKTFNRNSSLILHQRTHTGEKPYRCNECGKPFTDISHLTVHLRIHTGEKPYECSKCGK    281 - 350
AFRDGSYLTQHERTHTGEKPFECAECGKSFNRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRI    351 - 420
HTGEKPYGCNQCQKLFRNIAGLIRHQRTHTGEKPYECNQCGKAFRDSSCLTKHQRIHTKETPYQCPECGK    421 - 490
SFKQNSHLAVHQRLHSREGPSRCPQCGKMFQKSSSLVRHQRAHLGEQPMET                       491 - 541
//

Text Mined References (6)

PMID Year Title