Property Summary

NCBI Gene PubMed Count 8
PubMed Score 27.84
PubTator Score 106.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.500 2.6e-21
Atopic dermatitis -1.600 5.0e-05
atypical teratoid / rhabdoid tumor -1.100 4.7e-02
cystic fibrosis 1.274 7.7e-05
esophageal adenocarcinoma 1.100 3.9e-02
glioblastoma multiforme 1.100 4.3e-15
group 4 medulloblastoma -1.400 4.7e-03
interstitial cystitis 1.300 3.6e-05
lung cancer -1.600 4.6e-05
malignant mesothelioma -1.300 1.5e-06
medulloblastoma, large-cell -1.900 4.4e-05
oligodendroglioma 1.200 1.8e-09
osteosarcoma -2.420 1.8e-06
tuberculosis -2.000 3.2e-06

Gene RIF (2)

AA Sequence

MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM      1 - 70
CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH     71 - 140
EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL    141 - 210
YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV                               211 - 253
//

Text Mined References (11)

PMID Year Title