Property Summary

NCBI Gene PubMed Count 7
PubMed Score 27.52
PubTator Score 106.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
esophageal adenocarcinoma 1.100 0.039
astrocytoma 1.500 0.000
glioblastoma multiforme 1.100 0.000
oligodendroglioma 1.200 0.000
osteosarcoma -2.420 0.000
cystic fibrosis 1.274 0.000
atypical teratoid/rhabdoid tumor -1.400 0.003
medulloblastoma, large-cell -1.900 0.000
Atopic dermatitis -1.600 0.000
tuberculosis -2.000 0.000
lung cancer -1.600 0.000
interstitial cystitis 1.300 0.000
group 4 medulloblastoma -1.400 0.005

Synonym

Accession Q86UD3 A8K264 B9EJE7
Symbols RNF173
MARCH-III

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
26694610 LPS activation of TLR4 significantly increased MARCH3 expression and that siRNA against MARCH3 prevented the decrease in FcgammaRIIb following LPS treatment.

AA Sequence

MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM      1 - 70
CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH     71 - 140
EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL    141 - 210
YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV                               211 - 253
//

Text Mined References (10)

PMID Year Title
26694610 2016 Toll-like Receptor 4 Ligands Down-regulate Fc? Receptor IIb (Fc?RIIb) via MARCH3 Protein-mediated Ubiquitination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16428329 2006 MARCH-III Is a novel component of endosomes with properties similar to those of MARCH-II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14722266 2004 Downregulation of major histocompatibility complex class I by human ubiquitin ligases related to viral immune evasion proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.