Property Summary

NCBI Gene PubMed Count 3
PubMed Score 56.66
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ulcerative colitis 2087 2.19188920738237E-7
cystic fibrosis 1670 2.20833106368563E-4
medulloblastoma, large-cell 6234 2.65352384340317E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.2449058887874E-4
osteosarcoma 7933 7.03558059790993E-4
invasive ductal carcinoma 2950 0.00131952779645204
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00194367399004902
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00412004427990818
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0105377448541128
group 3 medulloblastoma 2254 0.0116233730559028
Rheumatoid Arthritis 1171 0.0283926918354722
active Crohn's disease 918 0.0341469557000849
Disease Target Count Z-score Confidence
psoriasis 6685 0.0 1.0
Disease Target Count Z-score Confidence
Sinusitis 30 4.405 2.2
Glottis carcinoma 2 4.142 2.1

Expression

Synonym

Accession Q86UD1
Symbols NS5ATP13TP2

Gene

OAF

  Ortholog (12)

AA Sequence

MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVS      1 - 70
FTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHL     71 - 140
HMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDH    141 - 210
GKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG           211 - 273
//

Text Mined References (4)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.