Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.62
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (12)

AA Sequence

MAGAAMAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTDARELPRGVLE      1 - 70
GLRQVAPASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPPQRLVFAPADEPRTVLERKPL     71 - 140
PLGVRAPLAGPSAAARSPEQLCAPAEAAPCPAEPERSQSAALEPSSSADAGAVACRALEADSGDARRAPR    141 - 210
ARGERRRHTIASGVDCGLLKQMKELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFG    211 - 280
AAGSPRPLGRLLPKVQEVARCLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLL    281 - 350
TQEVTEKSERITQLEQEKSALIKQLFEARALSQQDGGPLDSTFI                              351 - 394
//

Text Mined References (18)

PMID Year Title