Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.62
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26766442 results uncover SAPCD2 as a key regulator of the ternary complex controlling spindle orientation during morphogenesis and asymmetric cell divisions
26316259 p42.3 gene expression is associated with gastric mucosal inflammation that can be upregulated by TNF-alpha and H. pylori infection.
26106439 p42.3 has a role in the pathogenesis of gastric carcinoma
24927751 Overexpression of the p42.3 gene is associated with gliomas.
24608043 Role of C9orf140 in the promotion of colorectal cancer progression and mechanisms of its upregulation via activation of STAT5, beta-catenin and EZH2.
23704824 Up-regulation of p42.3 in hepatocellular carcinoma promotes tumorigenicity and tumor growth.
23576022 p42.3 might play an important role in the progression of colorectal cancer.
23228105 p42.3 protein plays an important role in the generation and development of gastric cancer.
23192843 p42.3 overexpression is associated with mitotic progression in malignant transformed cells.
21998710 the regulatory relationship between miRNAs and the p42.3 gene

AA Sequence

MAGAAMAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTDARELPRGVLE      1 - 70
GLRQVAPASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPPQRLVFAPADEPRTVLERKPL     71 - 140
PLGVRAPLAGPSAAARSPEQLCAPAEAAPCPAEPERSQSAALEPSSSADAGAVACRALEADSGDARRAPR    141 - 210
ARGERRRHTIASGVDCGLLKQMKELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFG    211 - 280
AAGSPRPLGRLLPKVQEVARCLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLL    281 - 350
TQEVTEKSERITQLEQEKSALIKQLFEARALSQQDGGPLDSTFI                              351 - 394
//

Text Mined References (16)

PMID Year Title
26766442 2016 SAPCD2 Controls Spindle Orientation and Asymmetric Divisions by Negatively Regulating the G?i-LGN-NuMA Ternary Complex.
26316259 2015 Positive relationship between p42.3 gene and inflammation in chronic non-atrophic gastritis.
26106439 2015 Optimization and Corroboration of the Regulatory Pathway of p42.3 Protein in the Pathogenesis of Gastric Carcinoma.
24927751 2014 Differential expression of p42.3 in low- and high-grade gliomas.
24608043 2014 Role of C9orf140 in the promotion of colorectal cancer progression and mechanisms of its upregulation via activation of STAT5, ?-catenin and EZH2.
23704824 2013 Overexpression of p42.3 promotes cell growth and tumorigenicity in hepatocellular carcinoma.
23576022 2013 p42.3: a promising biomarker for the progression and prognosis of human colorectal cancer.
23228105 2012 p42.3 gene expression in gastric cancer cell and its protein regulatory network analysis.
23192843 2014 Cell cycle-dependent expression of p42.3 promotes mitotic progression in malignant transformed cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...