Property Summary

NCBI Gene PubMed Count 8
Grant Count 19
R01 Count 6
Funding $1,468,175.62
PubMed Score 19.10
PubTator Score 11.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.400 0.002
osteosarcoma 2.358 0.000
medulloblastoma, large-cell -2.200 0.000
interstitial cystitis -1.400 0.001
nasopharyngeal carcinoma -1.600 0.000
ovarian cancer -1.600 0.000

Gene RIF (2)

PMID Text
26073779 RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes.
19684019 Radial spoke protein 3 is a mammalian protein kinase A-anchoring protein that binds ERK1/2.

AA Sequence

MTVKPAKAASLARNLAKRRRTYLGGAAGRSQEPEVPCAAVLPGKPGDRNCPEFPPPDRTLGCWATDAAPA      1 - 70
AGLCGAGSEPSIAPTSCAGNLPSRPPPLLSPLLASRNPCPWHYLHLSGSHNTLAPTCFKAKLHRKRGSQP     71 - 140
PDMASALTDRTSRAPSTYTYTSRPRALPCQRSRYRDSLTQPDEEPMHYGNIMYDRRVIRGNTYALQTGPL    141 - 210
LGRPDSLELQRQREARKRALARKQAQEQLRPQTPEPVEGRKHVDVQTELYLEEIADRIIEVDMECQTDAF    211 - 280
LDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYE    281 - 350
ELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSG    351 - 420
YFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEPGGP    421 - 490
GAMTESLEASEFLEQSMSQTRELLLDGGYLQRTTYDRRSSQERKFMEERELLGQDEETAMRKSLGEEELS    491 - 560
//

Text Mined References (9)

PMID Year Title
26073779 2015 RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes.
25416956 2014 A proteome-scale map of the human interactome network.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
19684019 2009 Radial spoke protein 3 is a mammalian protein kinase A-anchoring protein that binds ERK1/2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225872 2004 Genomic organisation and nervous system expression of radial spoke protein 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.