Property Summary

NCBI Gene PubMed Count 8
PubMed Score 12.44
PubTator Score 11.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.400 1.7e-03
interstitial cystitis -1.400 5.3e-04
medulloblastoma, large-cell -2.200 7.3e-05
nasopharyngeal carcinoma -1.600 1.0e-06
osteosarcoma -1.291 1.6e-03
ovarian cancer -1.600 9.5e-08

Gene RIF (2)

AA Sequence

MTVKPAKAASLARNLAKRRRTYLGGAAGRSQEPEVPCAAVLPGKPGDRNCPEFPPPDRTLGCWATDAAPA      1 - 70
AGLCGAGSEPSIAPTSCAGNLPSRPPPLLSPLLASRNPCPWHYLHLSGSHNTLAPTCFKAKLHRKRGSQP     71 - 140
PDMASALTDRTSRAPSTYTYTSRPRALPCQRSRYRDSLTQPDEEPMHYGNIMYDRRVIRGNTYALQTGPL    141 - 210
LGRPDSLELQRQREARKRALARKQAQEQLRPQTPEPVEGRKHVDVQTELYLEEIADRIIEVDMECQTDAF    211 - 280
LDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYE    281 - 350
ELRNSERAEVQRLEEQERRHREEKERRKKQQWEIMHKHNETSQKIAARAFAQRYLADLLPSVFGSLRDSG    351 - 420
YFYDPIERDIEIGFLPWLMNEVEKTMEYSMVGRTVLDMLIREVVEKRLCMYEHGEDTHQSPEPEDEPGGP    421 - 490
GAMTESLEASEFLEQSMSQTRELLLDGGYLQRTTYDRRSSQERKFMEERELLGQDEETAMRKSLGEEELS    491 - 560
//

Text Mined References (9)

PMID Year Title