Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.11
PubTator Score 16.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.600 4.3e-03
Breast cancer 2.000 3.8e-02
cystic fibrosis -1.229 2.9e-04
ependymoma 2.100 2.4e-03
group 3 medulloblastoma 1.300 2.7e-02
intraductal papillary-mucinous adenoma (... 1.300 2.0e-03
intraductal papillary-mucinous carcinoma... 1.700 5.2e-03
lung cancer 1.800 3.8e-03
oligodendroglioma 1.800 3.6e-03
osteosarcoma -2.731 5.1e-08
ovarian cancer -2.100 1.4e-11
pancreatic ductal adenocarcinoma liver m... -1.004 2.3e-02
Pick disease -1.400 1.3e-05
pituitary cancer -1.300 6.5e-04
primitive neuroectodermal tumor 1.300 5.8e-03
progressive supranuclear palsy -1.200 1.7e-02
psoriasis -3.600 2.5e-05

Gene RIF (5)

AA Sequence

MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN      1 - 70
ALQSVENCPEDLAQLEELIDMAVLEEIQQELIKQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVC     71 - 140
TKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCL    141 - 210
ACDTWAVIL                                                                 211 - 219
//

Text Mined References (16)

PMID Year Title