1. Home
  2. Targets
  3. RPA-interacting protein

Tbio RPA-interacting protein

Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.

 Comments

Property Summary

NCBI Gene PubMed Count 13
PubMed Score 22.11
PubTator Score 16.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.56435481760093E-13
ovarian cancer 8492 1.43848739305584E-11
Pick disease 1893 1.27518684670839E-5
psoriasis 6685 2.46860243374676E-5
lung cancer 4473 5.76844197553932E-5
cystic fibrosis 1670 2.89115383065497E-4
pituitary cancer 1972 6.52601582226888E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0019603302026914
ependymoma 2514 0.00235065382865408
oligodendroglioma 2849 0.00295039159151606
astrocytic glioma 2241 0.00323028821322094
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00519115731955289
primitive neuroectodermal tumor 3031 0.0057810675571995
progressive supranuclear palsy 674 0.0169258947701234
pancreatic ductal adenocarcinoma liver metastasis 1795 0.022507050952297
group 3 medulloblastoma 2254 0.0274904027060037
Breast cancer 3099 0.0382297880111965

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.900 0.003
ependymoma 2.100 0.002
oligodendroglioma 2.100 0.003
psoriasis -3.600 0.000
osteosarcoma -4.634 0.000
cystic fibrosis -1.229 0.000
primitive neuroectodermal tumor 1.300 0.006
pancreatic ductal adenocarcinoma liver m... -1.004 0.023
intraductal papillary-mucinous adenoma (... 1.300 0.002
intraductal papillary-mucinous carcinoma... 1.700 0.005
lung cancer 2.400 0.000
Breast cancer 2.000 0.038
group 3 medulloblastoma 1.300 0.027
Pick disease -1.400 0.000
progressive supranuclear palsy -1.200 0.017
ovarian cancer -2.100 0.000
pituitary cancer -1.300 0.001

Synonym

Accession Q86UA6 B4DI36 B4DTX7 E9PES3 J3KNH8 Q4G2Y0 Q4G2Y5 Q4G2Y8 Q6B4V9 Q6B4W0 Q6B4W1 Q6B4W4 Q86X49 Q9BT00 hRIP
Symbols RIP
HRIP

Gene

RPAIN

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (2)

 GO Component (4)

 GO Process (5)

 Compartment GO Term (30)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (1)

 UniProt Keyword (12)

See all...

Gene RIF (5)

PMID Text
23010595 hRIPalpha is involved in cell proliferation through regulation of RPA transport
21360055 The results show that DDX3, eIF5A, and hRIP enhance HIV-1 internal ribosomal entry site-mediated translation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
16135809 hRIPbeta localises to the PML nuclear body and transports replication protein A (PML) into the PML nuclear body and releases RPA upon UV irradiation.

AA Sequence 

MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN      1 - 70
ALQSVENCPEDLAQLEELIDMAVLEEIQQELIKQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVC     71 - 140
TKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCL    141 - 210
ACDTWAVIL                                                                 211 - 219
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23010595 2012 Elevated level of human RPA interacting protein ? (hRIP?) in cervical tumor cells is involved in cell proliferation through regulating RPA transport.
21360055 2011 Translational regulation of HIV-1 replication by HIV-1 Rev cellular cofactors Sam68, eIF5A, hRIP, and DDX3.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...