Tbio RPA-interacting protein

Add to cart

View Collections

Empty Collection

Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.

Comments

Property Summary

NCBI Gene PubMed Count	13
PubMed Score	24.11

PubTator Score	16.75

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
ovarian cancer	8520	1.4e-11
osteosarcoma	7950	5.1e-08
Pick disease	1894	1.3e-05
psoriasis	6694	2.5e-05
cystic fibrosis	1696	2.9e-04
pituitary cancer	1972	6.5e-04
intraductal papillary-mucinous adenoma (IPMA)	2955	2.0e-03
ependymoma	4679	2.4e-03
oligodendroglioma	2850	3.6e-03
lung cancer	4740	3.8e-03
astrocytic glioma	2597	4.3e-03
intraductal papillary-mucinous carcinoma (IPMC)	2989	5.2e-03
primitive neuroectodermal tumor	3035	5.8e-03
progressive supranuclear palsy	676	1.7e-02
pancreatic ductal adenocarcinoma liver metastasis	1962	2.3e-02
group 3 medulloblastoma	4104	2.7e-02
Breast cancer	3578	3.8e-02

Differential Expression (17)

Disease	log2 FC	p
astrocytic glioma	1.600	4.3e-03
Breast cancer	2.000	3.8e-02
cystic fibrosis	-1.229	2.9e-04
ependymoma	2.100	2.4e-03
group 3 medulloblastoma	1.300	2.7e-02
intraductal papillary-mucinous adenoma (...	1.300	2.0e-03
intraductal papillary-mucinous carcinoma...	1.700	5.2e-03
lung cancer	1.800	3.8e-03
oligodendroglioma	1.800	3.6e-03
osteosarcoma	-2.731	5.1e-08
ovarian cancer	-2.100	1.4e-11
pancreatic ductal adenocarcinoma liver m...	-1.004	2.3e-02
Pick disease	-1.400	1.3e-05
pituitary cancer	-1.300	6.5e-04
primitive neuroectodermal tumor	1.300	5.8e-03
progressive supranuclear palsy	-1.200	1.7e-02
psoriasis	-3.600	2.5e-05

Ovary 17,971

Uterus 17,618

Pituitary 18,147

Spleen 17,614

Brain - Cerebellar Hemisphere 18,015

Vagina 17,834

Nerve - Tibial 18,007

Cells - EBV-transformed lymphocytes 18,186

Thyroid 18,024

Artery - Aorta 17,896

Brain - Cerebellum 17,983

Artery - Coronary 17,949

Skin - Not Sun Exposed (Suprapubic) 18,081

Skin - Sun Exposed (Lower leg) 17,968

Prostate 18,213

Small Intestine - Terminal Ileum 17,954

Breast - Mammary Tissue 18,103

Adipose - Subcutaneous 18,110

Testis 18,518

Lung 18,057

Adipose - Visceral (Omentum) 17,937

Artery - Tibial 17,631

Esophagus - Gastroesophageal Junction 18,000

Esophagus - Mucosa 18,076

Colon - Sigmoid 18,089

Minor Salivary Gland 18,005

Esophagus - Muscularis 18,017

Adrenal Gland 18,071

Brain - Spinal cord (cervical c-1) 17,973

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Frontal Cortex (BA9) 18,069

Cells - Transformed fibroblasts 17,577

Stomach 17,879

Brain - Hypothalamus 18,169

Brain - Cortex 18,039

Colon - Transverse 17,825

Brain - Caudate (basal ganglia) 18,001

Heart - Atrial Appendage 17,896

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Amygdala 18,006

Brain - Hippocampus 18,011

Brain - Substantia nigra 17,981

Muscle - Skeletal 17,778

Liver 18,071

Brain - Putamen (basal ganglia) 17,863

Kidney - Cortex 17,329

Pancreas 18,123

Heart - Left Ventricle 18,006

Whole Blood 17,439

Fetal Ovary 9,118

CD4 Cells 7,773

B Cells 9,086

Adult Retina 10,115

Adult Gallbladder 7,612

Adult Pancreas 9,168

Fetal Brain 7,866

Adult Testis 10,836

CD8 Cells 9,840

Gall bladder

B-lymphocyte

Ovary

Pancreas

Testis

BTO:0004410

BTO:0005453

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Erythroleukemia cell 4,300

Eye 856

Corpus callosum 67

Placenta 3,079

See source...

Extensor digitorum longus 2

See source...

Synonym

Accession	Q86UA6 B4DI36 B4DTX7 E9PES3 J3KNH8 Q4G2Y0 Q4G2Y5 Q4G2Y8 Q6B4V9 Q6B4W0 Q6B4W1 Q6B4W4 Q86X49 Q9BT00 hRIP
Symbols	RIP HRIP

Gene

RPAIN

Ortholog (12)

Species	Source	Disease
Opossum 12,230	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Anole lizard 10,588	Inparanoid EggNOG
Chicken 7,827	Inparanoid OMA EggNOG
Zebrafish 9,726	OMA EggNOG
Xenopus 10,468	Inparanoid OMA EggNOG
Macaque 12,761	OMA EggNOG
Chimp 14,140	OMA EggNOG
Rat 15,117	Inparanoid OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Horse 14,252	Inparanoid OMA EggNOG
Dog 15,073	Inparanoid OMA EggNOG

UniProt Keyword (12)

Complete proteome 20,231

Metal-binding 3,672

Nucleus 5,259

Polymorphism 12,194

Reference proteome 20,231

Zinc 2,356

Zinc-finger 1,785

Alternative splicing 10,528

Cytoplasm 4,952

Isopeptide bond 1,739

See all...

GO Function (2)

metal ion binding 2,256

protein complex binding 231

GO Component (4)

nucleus 5,097

cytoplasm 4,094

fibrillar center 128

PML body 95

GO Process (5)

protein import into nucleus 54

DNA recombination 71

DNA repair 206

response to UV 42

DNA-dependent DNA replication 16

Compartment GO Term (32)

Cell 16,178

Cell part 16,177

Cytoplasm 10,983

DNA replication factor A complex 40

Fibrillar center 138

Intracellular 14,109

Intracellular membrane-bounded organelle 10,341

Intracellular non-membrane-bounded organ... 3,975

Intracellular organelle 12,025

Intracellular organelle lumen 5,090

Intracellular organelle part 8,783

Intracellular part 13,972

Nuclear body 725

Nuclear lumen 3,968

Nuclear part 4,290

See all...

GWAS Trait (1)

Menopause (age at onset) 59

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Protein-protein Interaction (2)

RPA1 UBR7

Gene RIF (5)

AA Sequence

MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN      1 - 70
ALQSVENCPEDLAQLEELIDMAVLEEIQQELIKQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVC     71 - 140
TKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCL    141 - 210
ACDTWAVIL                                                                 211 - 219
//

Text Mined References (16)

Summary
Details

	PMID	Year	Title

Tbio RPA-interacting protein Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression

Differential Expression (17)

Synonym

Gene

Ortholog (12)

UniProt Keyword (12)

GO Function (2)

GO Component (4)

GO Process (5)

Compartment GO Term (32)

GWAS Trait (1)

HCA RNA Cell Line (56)

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

Text Mined References (16)

Tbio RPA-interacting protein

Add to cart

View Collections

Empty Collection