Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.83
PubTator Score 2.50

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 3.73687454139174E-4
lung cancer 4473 0.0228759079355421
sonic hedgehog group medulloblastoma 1482 0.0363450372645077
Disease Target Count Z-score Confidence
Teratoma 4 3.278 1.6


  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 0.023
sonic hedgehog group medulloblastoma 1.200 0.036
Pick disease -1.400 0.000

Gene RIF (1)

22773733 Knockdown of PRPF39 expression resulted in a significant expression change of downstream gene.

AA Sequence

QMIDGDLQANQAVYNYSAWYQYNYQNPWNYGQYYPPPPT                                   631 - 669

Text Mined References (9)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22773733 2012 Functional consequences of PRPF39 on distant genes and cisplatin sensitivity.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.