Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.33
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 3.7e-04
lung cancer 4740 2.3e-02
sonic hedgehog group medulloblastoma 467 3.6e-02
Disease Target Count Z-score Confidence
Teratoma 8 3.287 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 2.3e-02
Pick disease -1.400 3.7e-04
sonic hedgehog group medulloblastoma 1.200 3.6e-02

Gene RIF (1)

AA Sequence

MQNSHMDEYRNSSNGSTGNSSEVVVEHPTDFSTEIMNVTEMEQSPDDSPNVNASTEETEMASAVDLPVTL      1 - 70
TETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDRFFIHYPYCYGYWKKYADLEK     71 - 140
RHDNIKPSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPGDPETNNTIRGTFEHAVLAAGTDFRSDRLWE    141 - 210
MYINWENEQGNLREVTAIYDRILGIPTQLYSHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSG    211 - 280
DDGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEK    281 - 350
AQLKNWKEYLEFEIENGTHERVVVLFERCVISCALYEEFWIKYAKYMENHSIEGVRHVFSRACTIHLPKK    351 - 420
PMVHMLWAAFEEQQGNINEARNILKTFEECVLGLAMVRLRRVSLERRHGNLEEAEHLLQDAIKNAKSNNE    421 - 490
SSFYAVKLARHLFKIQKNLPKSRKVLLEAIERDKENTKLYLNLLEMEYSGDLKQNEENILNCFDKAVHGS    491 - 560
LPIKMRITFSQRKVEFLEDFGSDVNKLLNAYDEHQTLLKEQDSLKRKAENGSEEPEEKKAHTEDTTSSST    561 - 630
QMIDGDLQANQAVYNYSAWYQYNYQNPWNYGQYYPPPPT                                   631 - 669
//

Text Mined References (9)

PMID Year Title