Property Summary

NCBI Gene PubMed Count 42
Grant Count 86
R01 Count 39
Funding $12,684,720.17
PubMed Score 158.49
PubTator Score 59.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q86U70 B4DUC4 O75479 O96010 Q1EQX1 Q9UGM4 LDB-1
Symbols NLI
CLIM2
LDB-1
CLIM-2

Gene

PDB

2XJY   2XJZ   2YPA  

Gene RIF (12)

PMID Text
26598604 Alanine scanning mutagenesis of the LIM interaction domain of LDB1 revealed a discrete motif, R(320)LITR, required for LMO2 binding.
26495868 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic beta-Cell Target Genes
25079073 Clim2, in a complex with LMO4, supports mammary stem cells by directly targeting the Fgfr2 promoter in basal cells to increase its expression
23812588 In t(8;21) leukemia cells, LDB1 functions as a component of the stable AML1-ETO-containing transcription factor complex (AETFC). The AETFC components cooperatively regulate gene expression and contribute to leukemogenesis.
22010104 We investigated NLI (Ldb1 homolog) complex occupancy and chromatin conformation of the beta-globin locus in human erythroid cells.
20447379 These studies are consistent with a model in which TIF1gamma acts to ubiquitinate LDB1 leading to degradation of LDB1 and changes in transcription of LDB1-dependent promoters.
20423330 Expression of LDB1 (LIM-domain-binding 1) protein in which Lys134 is replaced with arginine leads to enhanced expression of the mutant protein compared with the wild-type protein.
18583962 Although the LIM interaction domain of Ldb1 (Ldb1(LID)) and Isl1(LBD) share low levels of sequence homology, X-ray and NMR structures reveal that they bind Lhx3 in an identical manner, that is, Isl1(LBD) mimics Ldb1(LID).
17910069 characterize the assembly of a five-component complex containing TAL1, LMO2, Ldb1, E12, and DNA. The bHLH domains of TAL1 and E12 alone primarily formed helical homodimers, but together formed heterodimers, to which LMO2 bound with high affinity
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYR      1 - 70
IFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELY     71 - 140
YVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPR    141 - 210
SILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQR    211 - 280
MVAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEF    281 - 350
GDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ             351 - 411
//

Text Mined References (50)

PMID Year Title
26598604 2015 LMO2 Oncoprotein Stability in T-Cell Leukemia Requires Direct LDB1 Binding.
26495868 2015 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic ?-Cell Target Genes.
25416956 2014 A proteome-scale map of the human interactome network.
25079073 2014 The co-factor of LIM domains (CLIM/LDB/NLI) maintains basal mammary epithelial stem cells and promotes breast tumorigenesis.
23812588 2013 A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22010104 2011 Distinct Ldb1/NLI complexes orchestrate ?-globin repression and reactivation through ETO2 in human adult erythroid cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...