Property Summary

NCBI Gene PubMed Count 22
Grant Count 22
R01 Count 11
Funding $3,869,062.01
PubMed Score 38.58
PubTator Score 23.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
27281194 Structure of the METTL3-METTL14 complex
25456834 genetic inactivation impaired embryonic stem cells differentiation
24209618 Study identifies m(6)A methylation sites on many clock gene transcripts and shows that specific inhibition of m(6)A methylation by silencing of the m(6)A methylase Mettl3 is sufficient to elicit circadian period elongation and RNA processing delay.

AA Sequence

MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVP      1 - 70
ELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDA     71 - 140
HPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNSSASEPAKEPA    141 - 210
KKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGT    211 - 280
KEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPS    281 - 350
QELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP    351 - 420
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGN    421 - 490
PQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPD    491 - 560
VVARFKQRYPDGIISKPKNL                                                      561 - 580
//

Text Mined References (31)

PMID Year Title
27373337 2016 Structural Basis for Cooperative Function of Mettl3 and Mettl14 Methyltransferases.
27281194 2016 Structural basis of N(6)-adenosine methylation by the METTL3-METTL14 complex.
27117702 2016 The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
26593424 2015 5' UTR m(6)A Promotes Cap-Independent Translation.
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
26321680 2015 HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events.
25799998 2015 N6-methyladenosine marks primary microRNAs for processing.
25719671 2015 N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
25456834 2014 m(6)A RNA modification controls cell fate transition in mammalian embryonic stem cells.
24981863 2014 Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.
More...