Property Summary

NCBI Gene PubMed Count 30
PubMed Score 60.49
PubTator Score 23.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.500 4.7e-03
atypical teratoid / rhabdoid tumor 1.300 3.4e-04
dermatomyositis 1.200 7.9e-04
ependymoma 1.300 3.5e-03
group 3 medulloblastoma 1.200 4.8e-03
intraductal papillary-mucinous adenoma (... 1.100 2.2e-02
intraductal papillary-mucinous carcinoma... 1.200 3.8e-02
malignant mesothelioma -1.700 2.2e-07
oligodendroglioma 1.100 5.2e-03
osteosarcoma -1.369 3.0e-05
ovarian cancer -1.300 1.5e-06
Pick disease -1.600 5.6e-06
primitive neuroectodermal tumor 1.100 9.2e-04
progressive supranuclear palsy -1.100 1.0e-02
psoriasis -1.200 1.4e-03
Waldenstrons macroglobulinemia 1.581 1.6e-03

Gene RIF (9)

AA Sequence

MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVP      1 - 70
ELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDA     71 - 140
HPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNSSASEPAKEPA    141 - 210
KKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGT    211 - 280
KEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPS    281 - 350
QELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP    351 - 420
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGN    421 - 490
PQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPD    491 - 560
VVARFKQRYPDGIISKPKNL                                                      561 - 580
//

Text Mined References (39)

PMID Year Title