Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86U37 A8MT64
Symbols C14orf23
c14_5148

Gene

 Compartment GO Term (1)

AA Sequence

MELSSMKICAAIPTSRALPEVVRRMPRKRISGLEWLLQQDPGFSLVNTVKAGMIISFPSNNIYSSVCCCQ      1 - 70
SEIFKYEFSNSKKSSWIQEERHLGKNNVLYSAHDVSPEKVTSALKKTNKQTTTINNFPLQYLPGSKLLDR     71 - 140
FLSLSRSLLCLNSWSSSLPLAPQVKKK                                               141 - 167
//

Text Mined References (3)

PMID Year Title
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
16341674 2005 Transcriptome analysis of human gastric cancer.
12508121 2003 The DNA sequence and analysis of human chromosome 14.