Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
cystic fibrosis 1670 2.42155312772503E-5
pilocytic astrocytoma 3086 0.00112607725516434
ependymoma 2514 0.00199959936939403
astrocytic glioma 2241 0.00705966263410828
glioblastoma 5572 0.0103560223464064
group 3 medulloblastoma 2254 0.0179894251541432
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0

Expression

Synonym

Accession Q86U37 A8MT64
Symbols C14orf23
c14_5148

Gene

 Compartment GO Term (1)

AA Sequence

MELSSMKICAAIPTSRALPEVVRRMPRKRISGLEWLLQQDPGFSLVNTVKAGMIISFPSNNIYSSVCCCQ      1 - 70
SEIFKYEFSNSKKSSWIQEERHLGKNNVLYSAHDVSPEKVTSALKKTNKQTTTINNFPLQYLPGSKLLDR     71 - 140
FLSLSRSLLCLNSWSSSLPLAPQVKKK                                               141 - 167
//

Text Mined References (3)

PMID Year Title
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
16341674 2005 Transcriptome analysis of human gastric cancer.
12508121 2003 The DNA sequence and analysis of human chromosome 14.