Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
cystic fibrosis 1696 2.4e-05
Pilocytic astrocytoma 56 1.1e-03
ependymoma 4679 2.0e-03
astrocytic glioma 2597 7.1e-03
glioblastoma 5792 1.0e-02
group 3 medulloblastoma 4104 1.8e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.4

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 7.1e-03
cystic fibrosis 2.244 2.4e-05
ependymoma -1.400 2.0e-03
glioblastoma -1.100 1.0e-02
group 3 medulloblastoma 1.700 1.8e-02
Pilocytic astrocytoma -1.100 1.1e-03

Synonym

Accession Q86U37 A8MT64
Symbols C14orf23
c14_5148

 Compartment GO Term (1)

AA Sequence

MELSSMKICAAIPTSRALPEVVRRMPRKRISGLEWLLQQDPGFSLVNTVKAGMIISFPSNNIYSSVCCCQ      1 - 70
SEIFKYEFSNSKKSSWIQEERHLGKNNVLYSAHDVSPEKVTSALKKTNKQTTTINNFPLQYLPGSKLLDR     71 - 140
FLSLSRSLLCLNSWSSSLPLAPQVKKK                                               141 - 167
//

Text Mined References (3)

PMID Year Title