Property Summary

NCBI Gene PubMed Count 9
PubMed Score 26.44
PubTator Score 5.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Multiple Mitochondrial Dysfunctions Syndrome 3 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.3e-05
pancreatic ductal adenocarcinoma liver metastasis 1962 4.1e-03
Disease Target Count Z-score Confidence
Leukodystrophy 55 3.88 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.200 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.164 4.1e-03

Gene RIF (6)

AA Sequence

MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFL      1 - 70
RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA     71 - 140
QQGCSCGSSFSIKL                                                            141 - 154
//

Text Mined References (15)

PMID Year Title