Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q86U02
Symbols C14orf165
CNSLT1I7G

Gene

 Compartment GO Term (0)

AA Sequence

MFTLLLSNYYSRLEGWMMDNNFSHHWKGMFPTETESTVFCLFVYLFIFVFETASGFVAQTGVHWCNLGSL      1 - 70
QPLPPGFKRFSCLSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDWS                            71 - 117
//

Text Mined References (1)

PMID Year Title
12508121 2003 The DNA sequence and analysis of human chromosome 14.