Property Summary

NCBI Gene PubMed Count 5
Grant Count 14
R01 Count 4
Funding $1,586,637.7
PubMed Score 124.10
PubTator Score 61.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 0.000

AA Sequence

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGG      1 - 70
SFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVR     71 - 140
AGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEE    141 - 210
AVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRN    211 - 280
RIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP    281 - 350
QIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK    351 - 420
V//

Text Mined References (6)

PMID Year Title
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16940157 2006 Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.