Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
R01 Count 3
Funding $161,427.5
PubMed Score 1.09

Knowledge Summary

Patent (1,673)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466 1.0
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.062 0.000

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEYLQL      1 - 70
RSKSWPVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQV     71 - 140
IREDLGKEIHDLFQSFDDTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVRAQSSKDILLMEVLVLAVKQL    141 - 210
FPEFEFMWLVDEAKKNLPLELDFLNEGRNAEKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVND    211 - 280
RDYMERNKIDVNEISRHLGKMYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFR    281 - 350
LNYCHLWQSLIWTDMKRVKEYSQRLGAGDLYPLFACMLTARSWDSVNRGISQAPVTATEDLEIRNNAANY    351 - 420
LPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKKNTCSFFRRTQIS    421 - 490
FSEAFNLWQINLHELILRVKGLKLADRVLALICWLFPAPL                                  491 - 530
//

Text Mined References (8)

PMID Year Title
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.