Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.09

Knowledge Summary

Patent (1,673)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 8.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 1.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.062 8.7e-05

Gene RIF (1)

AA Sequence

MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEYLQL      1 - 70
RSKSWPVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQV     71 - 140
IREDLGKEIHDLFQSFDDTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVRAQSSKDILLMEVLVLAVKQL    141 - 210
FPEFEFMWLVDEAKKNLPLELDFLNEGRNAEKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVND    211 - 280
RDYMERNKIDVNEISRHLGKMYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFR    281 - 350
LNYCHLWQSLIWTDMKRVKEYSQRLGAGDLYPLFACMLTARSWDSVNRGISQAPVTATEDLEIRNNAANY    351 - 420
LPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKKNTCSFFRRTQIS    421 - 490
FSEAFNLWQINLHELILRVKGLKLADRVLALICWLFPAPL                                  491 - 530
//

Text Mined References (8)

PMID Year Title