Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.6e-07
psoriasis 6694 2.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.385 1.6e-07
psoriasis -1.500 2.1e-03

Synonym

Accession Q86TU6 A2RUP4
Symbols C14orf70

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MGIGTGHTSMNKGGKDVTLLELSVEKRRWRINMETSKIILEKMQSDDVLDGNRERSNEREGRDSLSEKLK      1 - 70
SKQNLKDEEKLRYIKTGKSIQVEGTVRAKALRWVQ                                        71 - 105
//

Text Mined References (3)

PMID Year Title