Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
lung carcinoma 4.000 0.000
pituitary cancer -3.100 0.000
psoriasis -1.400 0.000

Synonym

Accession Q86TS7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVQECCSQSLYYEELHSYHIVPYASENAIYEMGYTSSHLEQNSQLLIYKMN                         1 - 51
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.