Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.4e-52
psoriasis 6694 8.2e-18
atypical teratoid / rhabdoid tumor 5112 5.5e-07
pituitary cancer 1972 8.3e-05
group 4 medulloblastoma 1855 2.5e-03
Disease Target Count Z-score Confidence
Atrophic gastritis 5 3.196 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 5.5e-07
group 4 medulloblastoma -1.700 2.5e-03
lung carcinoma 4.000 1.4e-52
pituitary cancer -3.100 8.3e-05
psoriasis -1.400 8.2e-18

Synonym

Accession Q86TS7
Symbols

 Compartment GO Term (0)

AA Sequence

MVQECCSQSLYYEELHSYHIVPYASENAIYEMGYTSSHLEQNSQLLIYKMN                         1 - 51
//

Text Mined References (2)

PMID Year Title