Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.54
PubTator Score 3.66

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 2.614 0.000
group 3 medulloblastoma 1.700 0.002
medulloblastoma, large-cell 1.300 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.006
acute myeloid leukemia -1.600 0.041
ovarian cancer 1.400 0.001
dermatomyositis 1.400 0.000

Synonym

Accession Q86TP1 B2RCH8 B4DFL7 Q5SZF9 Q659E5 Q6P4E0 Q8N654 Q96JU5 Q9C071 Q9C072 Q9UIV0 hPrune
Symbols PRUNE
DRES17
HTCD37
DRES-17
H-PRUNE

Gene

  Ortholog (10)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25026278 Authors assessed h-Prune levels in peripheral blood of lung cancer patients using ELISA assay, showing that h-Prune is an early diagnostic marker for lung cancer.
23448979 Data indicate that the D388A and D422A mutant h-Prune proteins interact weakly with Nm23-H1.
20735841 Increased amplification of PRUNE is associated with T4 breast carcinoma.
18978678 Observational study of gene-disease association. (HuGE Navigator)
17655525 Prune is composed of two independent active sites and two interaction sites for the assembly of oligomeric signalling complexes
16428445 GSK-3 and h-prune cooperatively regulate the disassembly of focal adhesions to promote cell migration and that h-prune is useful as a marker for tumor aggressiveness.
15671547 prune has a role in breast neoplasm aggressiveness

AA Sequence

MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIV      1 - 70
FFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHV     71 - 140
SVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPK    141 - 210
RNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYD    211 - 280
VLVAMTIFFNTHNEPVRQLAIFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKK    281 - 350
LLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECP    351 - 420
LDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK                                         421 - 453
//

Text Mined References (28)

PMID Year Title
25138575 2015 A therapeutic approach to treat prostate cancer by targeting Nm23-H1/h-Prune interaction.
25026278 2014 H-Prune through GSK-3? interaction sustains canonical WNT/?-catenin signaling enhancing cancer progression in NSCLC.
23939913 2013 Mapping functional interaction sites of human prune C-terminal domain by NMR spectroscopy in human cell lysates.
23901273 2013 gH625 is a viral derived peptide for effective delivery of intrinsically disordered proteins.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23448979 2013 Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction.
23059542 2012 Novel pyrimidopyrimidine derivatives for inhibition of cellular proliferation and motility induced by h-prune in breast cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20735841 2010 Molecular alterations in key-regulator genes among patients with T4 breast carcinoma.
More...