Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.54
PubTator Score 3.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 2.614 0.000
group 3 medulloblastoma 1.700 0.002
medulloblastoma, large-cell 1.300 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.006
acute myeloid leukemia -1.600 0.041
ovarian cancer 1.400 0.001
dermatomyositis 1.400 0.000

Synonym

Accession Q86TP1 B2RCH8 B4DFL7 Q5SZF9 Q659E5 Q6P4E0 Q8N654 Q96JU5 Q9C071 Q9C072 Q9UIV0 hPrune
Symbols PRUNE
DRES17
HTCD37
DRES-17
H-PRUNE

Gene

Gene RIF (7)

PMID Text
25026278 Authors assessed h-Prune levels in peripheral blood of lung cancer patients using ELISA assay, showing that h-Prune is an early diagnostic marker for lung cancer.
23448979 Data indicate that the D388A and D422A mutant h-Prune proteins interact weakly with Nm23-H1.
20735841 Increased amplification of PRUNE is associated with T4 breast carcinoma.
18978678 Observational study of gene-disease association. (HuGE Navigator)
17655525 Prune is composed of two independent active sites and two interaction sites for the assembly of oligomeric signalling complexes
16428445 GSK-3 and h-prune cooperatively regulate the disassembly of focal adhesions to promote cell migration and that h-prune is useful as a marker for tumor aggressiveness.
15671547 prune has a role in breast neoplasm aggressiveness

AA Sequence

MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIV      1 - 70
FFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHV     71 - 140
SVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPK    141 - 210
RNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYD    211 - 280
VLVAMTIFFNTHNEPVRQLAIFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKK    281 - 350
LLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECP    351 - 420
LDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK                                         421 - 453
//

Text Mined References (28)

PMID Year Title
25138575 2015 A therapeutic approach to treat prostate cancer by targeting Nm23-H1/h-Prune interaction.
25026278 2014 H-Prune through GSK-3? interaction sustains canonical WNT/?-catenin signaling enhancing cancer progression in NSCLC.
23939913 2013 Mapping functional interaction sites of human prune C-terminal domain by NMR spectroscopy in human cell lysates.
23901273 2013 gH625 is a viral derived peptide for effective delivery of intrinsically disordered proteins.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23448979 2013 Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction.
23059542 2012 Novel pyrimidopyrimidine derivatives for inhibition of cellular proliferation and motility induced by h-prune in breast cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20735841 2010 Molecular alterations in key-regulator genes among patients with T4 breast carcinoma.
More...