Property Summary

Ligand Count 3
NCBI Gene PubMed Count 24
PubMed Score 27.77
PubTator Score 3.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.600 4.1e-02
dermatomyositis 1.400 1.8e-04
group 3 medulloblastoma 1.300 8.4e-04
intraductal papillary-mucinous adenoma (... 1.100 6.3e-03
malignant mesothelioma 1.200 2.3e-05
medulloblastoma, large-cell 1.300 4.4e-06
osteosarcoma 2.614 7.9e-07
ovarian cancer 1.400 5.3e-04

Gene RIF (11)

AA Sequence

MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIV      1 - 70
FFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHV     71 - 140
SVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPK    141 - 210
RNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYD    211 - 280
VLVAMTIFFNTHNEPVRQLAIFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKK    281 - 350
LLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECP    351 - 420
LDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK                                         421 - 453
//

Text Mined References (33)

PMID Year Title