Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.43
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.7e-04
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.1

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.7e-04

Gene RIF (1)

AA Sequence

MNFSGGGRQEAAGSRGRRAPRPREQDRDVQLSKALSYALRHGALKLGLPMGADGFVPLGTLLQLPQFRGF      1 - 70
SAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSI     71 - 140
LLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLL    141 - 210
PKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ                               211 - 253
//

Text Mined References (15)

PMID Year Title