Property Summary

NCBI Gene PubMed Count 78
PubMed Score 36.24
PubTator Score 79.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.100 1.8e-02
ependymoma 1.100 2.1e-02
lung adenocarcinoma 1.100 1.5e-09
non primary Sjogren syndrome sicca 1.200 1.9e-02
oligodendroglioma 1.100 1.1e-02
ovarian cancer 1.200 1.5e-04
pancreatic ductal adenocarcinoma liver m... -1.177 1.5e-03

 GWAS Trait (1)

Gene RIF (51)

AA Sequence

MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLR      1 - 70
AAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCR     71 - 140
IVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSENPWDNKAV    141 - 210
YMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDAT    211 - 280
PEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPAD    281 - 350
QGPPPAPHPPPLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGA    351 - 420
ATTTAAGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELR    421 - 490
ALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIP    491 - 560
SSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDAAELRRRRLQKLESPVAH                 561 - 617
//

Text Mined References (86)

PMID Year Title