Property Summary

NCBI Gene PubMed Count 11
Grant Count 107
R01 Count 62
Funding $13,169,024
PubMed Score 847.71
PubTator Score 626.47

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q86TM3 Q0D2N2 Q6NVV4
Symbols CAGE
CT26

Gene

PDB

3IUY  

Gene RIF (8)

PMID Text
20534591 CAGE induced the interaction between histone deacetylase 2 (HDAC2) and Snail, which exerted a negative effect on p53 expression in neoplastic cells; CAGE confers drug resistance by regulating expression of p53 through HDAC2.
20531469 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18388483 The CAGE gene is widely expressed in various cancer tissues and cancer cell lines.
18187620 Knockdown of DEAD (Asp-Glu-Ala-Asp) box polypeptide 53 (DDX53) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17341616 Hypomethylated CAGE promoter CpG islands are frequently involved in uterine cervical carcinogenesis.
17028776 CAGE promotes motility of cancer cells through activation of focal adhesion kinase (FAK).
12849980 results suggest that the methylation status of the CpG sites of CAGE determines its expression, and that hypomethylation of CAGE precedes the development of gastric cancer and hepatocellular carcinoma
11922625 CAGE is expressed in a variety of cancers but not in normal tissues except testis, and might play a role in cellular proliferation.

AA Sequence

MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMVGVVIGYSGSK      1 - 70
IKDLQHSTNTKIQIINGESEAKVRIFGNREMKAKAKAAIETLIRKQESYNSESSVDNAASQTPIGRNLGR     71 - 140
NDIVGEAEPLSNWDRIRAAVVECEKRKWADLPPVKKNFYIESKATSCMSEMQVINWRKENFNITCDDLKS    141 - 210
GEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPG    211 - 280
FIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIII    281 - 350
ATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALS    351 - 420
YLKDPMIVYVGNLNLVAVNTVKQNIIVTTEKEKRALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQ    421 - 490
GISAESLHGNSEQSDQERAVEDFKSGNIKILITTDIVSRGLDLNDVTHVYNYDFPRNIDVYVHRVGYIGR    491 - 560
TGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVMAEQYKLNQQKRHRETRSRKPGQRRKEFYFL    561 - 630
S//

Text Mined References (12)

PMID Year Title
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20534591 2010 Cancer/testis antigen CAGE exerts negative regulation on p53 expression through HDAC2 and confers resistance to anti-cancer drugs.
20531469 2010 Functional impact of global rare copy number variation in autism spectrum disorders.
18388483 2008 Role of CAGE, a novel cancer/testis antigen, in various cellular processes, including tumorigenesis, cytolytic T lymphocyte induction, and cell motility.
17341616 2006 DNA hypomethylation of CAGE promotors in squamous cell carcinoma of uterine cervix.
17028776 2006 Cancer/testis antigen cancer-associated gene (CAGE) promotes motility of cancer cells through activation of focal adhesion kinase (FAK).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12849980 2003 Promoter hypomethylation of a novel cancer/testis antigen gene CAGE is correlated with its aberrant expression and is seen in premalignant stage of gastric carcinoma.
More...