Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.12
PubTator Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Ascaridiasis 3 5.663 2.8
Von Willebrand's disease 19 4.59 2.3

Expression

Gene RIF (2)

AA Sequence

MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREPKHERRPWRIW      1 - 70
FLDTSKQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYVGVRAVSVLVEWQQWESLRFG     71 - 140
EYGDPLQCGAWVGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIVPFFVNALMF    141 - 210
WVVDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPL    211 - 280
KPVKKKKHRFGLPV                                                            281 - 294
//

Text Mined References (11)

PMID Year Title