Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.84747147260327E-6
atypical teratoid / rhabdoid tumor 4369 8.62650063456125E-5
pediatric high grade glioma 2712 8.69770671340128E-5
medulloblastoma, large-cell 6234 1.96830788833013E-4
glioblastoma 5572 3.49744896931481E-4

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.294 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.300 0.000
pediatric high grade glioma -1.100 0.000

Synonym

Accession Q86TJ5 Q8NAT3 Q9BWN3
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

AA Sequence

MVTCAHLGRRARLPAAQPSACPGTCFSQEERMAAGYLPRWSQELVTFEDVSMDFSQEEWELLEPAQKNLY      1 - 70
REVMLENYRNVVSLEALKNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEK     71 - 140
GTPQASCSDWMTVLRNQDSTYKKVALQEEPASGINMIKLIREDGGWKQLEDSHEDPQGLLSQKASLHVVA    141 - 210
VPQEKATAWHGFGENGNLSPALVLSQGSSKGNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGN    211 - 280
AIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKPFECHQCGKVFNRRHSLSEHQRIHTGEK    281 - 350
PYECQECGRAFTHSSTLTRHLRTHTGEKPYGCGECGKAFNRISSLTQHQRIHTGEKPYKCEDCGKSFCQS    351 - 420
SYLILHKRTHTGEKPYECSECGKAFSDRSSLNQHERTHTGENPYECKQCGRAFSQRSSLVRHERTHTGEK    421 - 490
PYRCQECGKAFSQSSSLVTHQKTHSSQKTYKIIDCGKAFYQNRHLIGY                          491 - 538
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.