Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.4e-05
invasive ductal carcinoma 2951 1.1e-02
Breast cancer 3578 2.4e-02
chronic rhinosinusitis 512 2.7e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -3.500 2.4e-02
chronic rhinosinusitis -1.159 2.7e-02
invasive ductal carcinoma -1.200 1.1e-02
osteosarcoma -2.030 2.4e-05

AA Sequence

MGGGGSALRVCADHRGGINWLSLSPDGQRLLTGSEDGTARLWSTADGQCCALLQGHESYVTFCQLEDEAA      1 - 70
FTCSADCTIRRWDVLTGQCLQVYRGHTSIVNRILVANNQLFSSSYDRTARVWSVDKGQMSREFRGHRNCV     71 - 140
LTLAYSAPWDLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLCLVLDTPGHTAFT    141 - 210
GSTDATIRAWDILSGEQLRVFREHRGSVICLELVNRLVYSGSADRTVKCWLADTGECVRTFTAHRRNVSA    211 - 280
LKYHAGTLFTGSGDACARAFDAQSGELRRVFRGHTFIINCIQVHGQVLYTASHDGALRLWDVRGLRGAPR    281 - 350
PPPPMRSLSRLFSNKVGCAAAPLQPA                                                351 - 376
//

Text Mined References (5)

PMID Year Title