Property Summary

Ligand Count 214
NCBI Gene PubMed Count 34
PubMed Score 55.76
PubTator Score 44.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Idiopathic pulmonary fibrosis 23 0.0 0.0
Disease Target Count
Diabetes mellitus type 2 69
Disease Target Count P-value
Polycystic ovary syndrome 360 2.0e-03
diabetes mellitus 1728 7.0e-03
non primary Sjogren syndrome sicca 891 1.5e-02
Disease Target Count Z-score Confidence
interstitial lung disease 298 0.0 3.0
Disease Target Count
Pulmonary Fibrosis, Idiopathic 12

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 7.0e-03
non primary Sjogren syndrome sicca 1.100 1.5e-02
Polycystic ovary syndrome -1.072 2.0e-03

 GWAS Trait (1)

Pathway (1)

Protein-protein Interaction (5)

Gene RIF (24)

AA Sequence

MATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSH      1 - 70
RLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGIT     71 - 140
SYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLW    141 - 210
VANIETGEERRLTFCHQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEV    211 - 280
DESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVE    281 - 350
YIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVW    351 - 420
INVHDIFYPFPQSEGEDELCFLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALT    421 - 490
SGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFV    491 - 560
SHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHA    561 - 630
LQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQV    631 - 700
EIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERY    701 - 770
MDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERH    771 - 840
SIRCPESGEHYEVTLLHFLQEYL                                                   841 - 863
//

Text Mined References (39)

PMID Year Title