Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.31
PubTator Score 44.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Diabetes mellitus type 2 69
Disease Target Count P-value
Polycystic Ovary Syndrome 335 0.00195572275445237
non primary Sjogren syndrome sicca 840 0.015024059682955
Disease Target Count Z-score Confidence
interstitial lung disease 292 0.0 2.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.47 1.7
Disease Target Count
Pulmonary Fibrosis, Idiopathic 12

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 0.007
non primary Sjogren syndrome sicca 1.100 0.015
Polycystic Ovary Syndrome -1.072 0.002

Synonym

Accession Q86TI2 O75273 O75868 Q1ZZB8 Q6AI37 Q6UAL0 Q6ZMT2 Q6ZNJ5 Q8N2J7 Q8N3F5 Q8WXD8 Q96NT8 Q9BVR3 DP9
Symbols DP9
DPLP9
DPRP2
DPRP-2

Gene

PANTHER Protein Class (3)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

 GWAS Trait (1)

Gene RIF (22)

PMID Text
25486458 There was a concomitant decrease in the phosphorylation of focal adhesion kinase and paxillin, indicating that DPP9 knockdown or enzyme inhibition suppressed the associated adhesion signaling pathway, causing impaired cell movement.
25464020 The DPP9 expressing cell model system is a very useful and promising system for investigating the selectivity and associated toxicity of DPP4 inhibitors on DPP9.
24562348 Whereas DPP9-short is present in the cytosol, DPP9-long localizes preferentially to the nucleus.
24072711 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23704821 Suggest roles for DPP8 and DPP9 in lymphocyte activation and apoptosis and in hepatocytes during liver disease pathogenesis.
23608773 DPP9 was found in macrophages of carotid atherosclerotic plaque and may play a role in disease progression.
23519473 analysis of dipeptidyl peptidases 8 and 9 reveals that they may have compensatory roles
23152501 DPP9 binds to SUMO1 through a novel SUMO1 interacting motif.
22736146 this study demonstrates for the first time that DP8 and DP9 are expressed in breast and ovarian carcinoma cell lines
22001206 residues important for dimer formation and enzymatic activity
More...

AA Sequence

MATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSH      1 - 70
RLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGIT     71 - 140
SYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLW    141 - 210
VANIETGEERRLTFCHQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEV    211 - 280
DESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVE    281 - 350
YIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVW    351 - 420
INVHDIFYPFPQSEGEDELCFLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALT    421 - 490
SGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFV    491 - 560
SHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHA    561 - 630
LQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQV    631 - 700
EIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERY    701 - 770
MDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERH    771 - 840
SIRCPESGEHYEVTLLHFLQEYL                                                   841 - 863
//

Text Mined References (37)

PMID Year Title
25486458 2015 Dipeptidyl peptidase 9 subcellular localization and a role in cell adhesion involving focal adhesion kinase and paxillin.
25464020 Establishment of a dipeptidyl peptidases (DPP) 8/9 expressing cell model for evaluating the selectivity of DPP4 inhibitors.
24562348 2014 The amino terminus extension in the long dipeptidyl peptidase 9 isoform contains a nuclear localization signal targeting the active peptidase to the nucleus.
24072711 2013 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23704821 2013 Regulation of dipeptidyl peptidase 8 and 9 expression in activated lymphocytes and injured liver.
23608773 2013 Dipeptidyl peptidases in atherosclerosis: expression and role in macrophage differentiation, activation and apoptosis.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23519473 2013 Identifying natural substrates for dipeptidyl peptidases 8 and 9 using terminal amine isotopic labeling of substrates (TAILS) reveals in vivo roles in cellular homeostasis and energy metabolism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152501 2012 A novel SUMO1-specific interacting motif in dipeptidyl peptidase 9 (DPP9) that is important for enzymatic regulation.
More...