Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.30
PubTator Score 10.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Weill-Marchesani syndrome 14 6.675 3.3
Brachydactyly 156 4.762 2.4
Disease Target Count
GELEOPHYSIC DYSPLASIA 1 1

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -1.206 1.8e-09
aldosterone-producing adenoma -1.158 1.9e-02
atypical teratoid/rhabdoid tumor -1.200 8.8e-06
group 4 medulloblastoma -1.500 7.8e-05
medulloblastoma, large-cell -1.200 5.0e-04

Gene RIF (4)

AA Sequence

MDGRWQCSCWAWFLLVLAVVAGDTVSTGSTDNSPTSNSLEGGTDATAFWWGEWTKWTACSRSCGGGVTSQ      1 - 70
ERHCLQQRRKSVPGPGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCVSFNSHVYNGRTHQWKPLYPDDY     71 - 140
VHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVCVSGKCEPIGCDGVLFSTHTLDKCGICQGDG    141 - 210
SSCTHVTGNYRKGNAHLGYSLVTHIPAGARDIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIA    211 - 280
GTVVKYRRPMDVYETGIEYIVAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHESRPQPIYYGFSESA    281 - 350
ESQGLDGAGLMGFVPHNGSLYGQASSERLGLDNRLFGHPGLDMELGPSQGQETNEVCEQAGGGACEGPPR    351 - 420
GKGFRDRNVTGTPLTGDKDDEEVDTHFASQEFFSANAISDQLLGAGSDLKDFTLNETVNSIFAQGAPRSS    421 - 490
LAESFFVDYEENEGAGPYLLNGSYLELSSDRVANSSSEAPFPNVSTSLLTSAGNRTHKARTRPKARKQGV    491 - 560
SPADMYRWKLSSHEPCSATCTTGVMSAYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQPRWETSS    561 - 630
WSECSRTCGEGYQFRVVRCWKMLSPGFDSSVYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECTAK    631 - 700
CGERSVVTRDIRCSEDEKLCDPNTRPVGEKNCTGPPCDRQWTVSDWGPCSGSCGQGRTIRHVYCKTSDGR    701 - 770
VVPESQCQMETKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPECGLA    771 - 840
KKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTE    841 - 910
PPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS                                 911 - 951
//

Text Mined References (11)

PMID Year Title