Property Summary

NCBI Gene PubMed Count 40
Grant Count 27
R01 Count 13
Funding $4,050,508.5
PubMed Score 363.53
PubTator Score 194.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 3.464 0.010
posterior fossa group B ependymoma -1.500 0.000
adrenocortical carcinoma -1.405 0.047
intraductal papillary-mucinous adenoma (... -1.100 0.002
Hydrolethalus syndrome -2.078 0.021
lung cancer 4.400 0.000
colon cancer -2.300 0.000
Breast cancer 3.400 0.047
interstitial cystitis -3.500 0.000
atypical teratoid/rhabdoid tumor 1.500 0.029
group 4 medulloblastoma 1.800 0.018
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -3.098 0.004
invasive ductal carcinoma -1.805 0.002
lung carcinoma 2.500 0.000
non-small cell lung carcinoma -1.100 0.000
Pick disease -1.900 0.000
pituitary cancer 1.400 0.016
Down syndrome 1.800 0.003

Gene RIF (25)

PMID Text
26680220 important role in trophoblast proliferation and promotes trophoblast invasion through TIMP-1
25526181 The downregulated expression of the imprinted gene PEG10 may be an important reason for the occurrence of preeclampsia.
25199998 Results revealed that PEG10 high expression was closely associated with the TNM classification in lung cancer and is a critical indicator for poor prognosis. Also, It promotes significantly proliferation, migration and invasion of A549 lung cancer cells.
22673314 promotes migration of Burkitt's lymphoma cells via upregulation of matrix metalloproteinase-2 and -9
22137777 elevated expression of PEG10 is likely to be involved in the pathophysiology of preeclampsia
21767414 the mRNA expression level of PEG10 were significantly up-regulated in tumorous liver tissues compared with corresponding nontumorous counterparts.
21455631 Overexpression of PEG10 and TSG101 was detected in gallbladder adenocarcinoma.
21205473 PEG10 imprinting is lost in a majority of hepatocellular carcinomas and no correlation exists between the imprinting status of PEG10 and its expression in HCC tissues.
20484977 In third trimester PEG10 was downregulated in fetal samples group
20460050 miR-122 may be involved in regulation of PEG10 expression hepatoma cell lines.
More...

AA Sequence

MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIELRGAAAAAAP      1 - 70
PPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERS     71 - 140
HYLMHNYPAFMMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGL    141 - 210
SDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMR    211 - 280
LTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSSPAGKLPGPAVEGPSATGPEIIRSPQDDASSPHLQ    281 - 350
VMLQIHLPGRHTLFVRAMIDSGASGNFIDHEYVAQNGIPLRIKDWPILVEAIDGRPIASGPVVHETHDLI    351 - 420
VDLGDHREVLSFDVTQSPFFPVVLGVRWLSTHDPNITWSTRSIVFDSEYCRYHCRMYSPIPPSLPPPAPQ    421 - 490
PPLYYPVDGYRVYQPVRYYYVQNVYTPVDEHVYPDHRLVDPHIEMIPGAHSIPSGHVYSLSEPEMAALRD    491 - 560
FVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAPNNFTIQNQYPRLSIPNLEDQAHLATYTEFV    561 - 630
PQIPGYQTYPTYAAYPTYPVGFAWYPVGRDGQGRSLYVPVMITWNPHWYRQPPVPQYPPPQPPPPPPPPP    631 - 700
PPPSYSTL                                                                  701 - 708
//

Text Mined References (46)

PMID Year Title
26680220 2015 Silencing of Paternally Expressed Gene 10 Inhibits Trophoblast Proliferation and Invasion.
25526181 2014 Expression and significance of the imprinted gene PEG10 in placenta of patients with preeclampsia.
25416956 2014 A proteome-scale map of the human interactome network.
25199998 2014 PEG10 plays a crucial role in human lung cancer proliferation, progression, prognosis and metastasis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22673314 2012 PEG10 promotes the migration of human Burkitt's lymphoma cells by up-regulating the expression of matrix metalloproteinase-2 and -9.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22137777 2012 Elevated expression of PEG10 in human placentas from preeclamptic pregnancies.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21767414 2011 Digital karyotyping reveals probable target genes at 7q21.3 locus in hepatocellular carcinoma.
More...