Property Summary

NCBI Gene PubMed Count 47
PubMed Score 384.93
PubTator Score 194.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.405 4.7e-02
Astrocytoma, Pilocytic -1.100 6.2e-05
atypical teratoid/rhabdoid tumor 1.500 2.9e-02
Breast cancer 3.400 4.7e-02
colon cancer -1.200 3.8e-03
Down syndrome 1.800 2.7e-03
ependymoma -1.300 1.1e-04
group 4 medulloblastoma 1.800 1.8e-02
Hydrolethalus syndrome -1.635 2.9e-02
interstitial cystitis -3.200 3.8e-04
intraductal papillary-mucinous adenoma (... -1.100 1.5e-03
invasive ductal carcinoma -1.805 2.0e-03
lung cancer 4.400 7.9e-07
lung carcinoma 2.500 1.8e-22
non-small cell lung carcinoma -1.100 1.7e-07
osteosarcoma 2.445 1.2e-02
Pick disease -1.900 3.6e-04
pituitary cancer 1.400 1.6e-02
subependymal giant cell astrocytoma -3.098 4.3e-03

Gene RIF (31)

AA Sequence

MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIELRGAAAAAAP      1 - 70
PPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERS     71 - 140
HYLMHNYPAFMMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGL    141 - 210
SDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMR    211 - 280
LTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSSPAGKLPGPAVEGPSATGPEIIRSPQDDASSPHLQ    281 - 350
VMLQIHLPGRHTLFVRAMIDSGASGNFIDHEYVAQNGIPLRIKDWPILVEAIDGRPIASGPVVHETHDLI    351 - 420
VDLGDHREVLSFDVTQSPFFPVVLGVRWLSTHDPNITWSTRSIVFDSEYCRYHCRMYSPIPPSLPPPAPQ    421 - 490
PPLYYPVDGYRVYQPVRYYYVQNVYTPVDEHVYPDHRLVDPHIEMIPGAHSIPSGHVYSLSEPEMAALRD    491 - 560
FVARNVKDGLITPTIAPNGAQVLQVKRGWKLQVSYDCRAPNNFTIQNQYPRLSIPNLEDQAHLATYTEFV    561 - 630
PQIPGYQTYPTYAAYPTYPVGFAWYPVGRDGQGRSLYVPVMITWNPHWYRQPPVPQYPPPQPPPPPPPPP    631 - 700
PPPSYSTL                                                                  701 - 708
//

Text Mined References (53)

PMID Year Title