Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.47
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ovarian cancer 1.200 4.0e-07
astrocytic glioma 1.300 1.5e-02
Astrocytoma, Pilocytic 1.200 9.8e-05
inflammatory breast cancer -1.400 2.5e-04
psoriasis 2.500 3.6e-75

Gene RIF (2)

AA Sequence

MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQSLKNDEQSAK      1 - 70
TDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVERKSKMIRDLQNENKSLKNKL     71 - 140
LSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTDLEQKLAVAKNELEKAALDRESQMKAMKETV    141 - 210
QLCLTSVFRDQPPPPLSLITSNPTRMLLPPRNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTT    211 - 280
ACDSQDEGRPCSMKHKESPPSNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL        281 - 346
//

Text Mined References (16)

PMID Year Title