Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.69
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.904 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.000
primary pancreatic ductal adenocarcinoma 1.271 0.007
Breast cancer 3.400 0.029
pediatric high grade glioma 1.100 0.000
group 4 medulloblastoma 1.100 0.002
ovarian cancer 1.100 0.000
pancreatic cancer 1.300 0.008

Gene RIF (8)

PMID Text
23535175 data indicate that P-body assembly occurs in a step-wise manner, where Rck participates in the initial suppression of mRNA translation, whereas Pat1b in a second step triggers P-body assembly and promotes mRNA decapping
22437941 The PATL1 as well as DCP1A, a well-known P-body marker, co-localized with a subset of ALG-2.
22090346 Pat1b participates in several RNA-related nuclear processes in addition to its multiple regulatory roles in the cytoplasm
20852261 Pat1b represses gene expression by inducing deadenylation of the mRNAs.
20826699 hPat1b localizes to P-bodies, while mPat1a-GFP is either found weakly in P-bodies or disperses P-bodies in a dominant-negative fashion.
20584987 By tethering Pat1b to a reporter mRNA, the study provides evidence that Pat1b is also functionally linked to both deadenylation and decapping.
20543818 Data show that PatL1 is essential for the interaction with mRNA decapping factors (i.e. DCP2, EDC4 and LSm1-7), whereas the P-rich region and Mid domain have distinct functions in modulating these interactions.
17936923 The identification of two human PAT1 genes is described and one of them, PATL1, codes for an open reading frame with similar features as the yeast PAT1.

AA Sequence

MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKLPVAVNEQTGN      1 - 70
GERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGSLNSSIWDGSEVLRRIRGPLL     71 - 140
AQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFTQQILC    141 - 210
PKPVHVRPPMPPRYPAPYGERMSPNQLCSVPNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPS    211 - 280
QFARVPGFVGSPLAAMNPKLLQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMF    281 - 350
RPDTTHLHPQHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQ    351 - 420
LQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEGSLGKLTVSSV    421 - 490
NNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKH    491 - 560
KICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARNLPFLIKKDAQD    561 - 630
EVLPCLLSPFSLLLYHLPSVSITSLLRQLMNLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQ    631 - 700
SSDPATESTQNNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR    701 - 770
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23535175 2013 Role of Rck-Pat1b binding in assembly of processing-bodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22437941 2012 Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins.
22090346 2012 RNA-related nuclear functions of human Pat1b, the P-body mRNA decay factor.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...