Knowledge Summary

Patent

No data available

Synonym

Accession Q86TA4
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLEGVSNEFDHFGISLPLKICLHLGWDEGLVEGKVVRLGQGIGKSICSSCQLFEEAPTQMSTVPSGLPLP      1 - 70
ILMHLCLLPVCMAHLCPASPCYFGATPGSGKFCRLITYSHSSPQLAASLRHRGREVGKDLPYPGLCPLTF     71 - 140
HPSFFPPVEGCVSSLPGKLLSPQTIFFQILWLYSKSSLVL                                  141 - 180
//

Text Mined References (2)

PMID Year Title