Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.06
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.300 0.034
malignant mesothelioma -1.200 0.000
osteosarcoma 1.044 0.013
chronic lymphosyte leukemia -1.600 0.000
group 3 medulloblastoma -2.600 0.000
cystic fibrosis -1.742 0.000
medulloblastoma, large-cell -1.800 0.015
non-small cell lung cancer -1.473 0.000
lung cancer -2.000 0.001
breast carcinoma -1.600 0.000
pediatric high grade glioma -1.100 0.010
atypical teratoid/rhabdoid tumor -1.400 0.006
subependymal giant cell astrocytoma -2.627 0.005
lung adenocarcinoma -1.600 0.000
invasive ductal carcinoma -2.800 0.001
Breast cancer -3.100 0.000
lung carcinoma -1.600 0.000
ductal carcinoma in situ -1.500 0.001
pituitary cancer -1.100 0.000

Synonym

Accession Q86TA1 Q8NEB4 Q9H8V4
Symbols MOB1D
C9orf35
MOBKL2B

Gene

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (6)

PMID Text
26130958 low levels of hMOB3B are closely associated with aggressive clinicopathologic features in patients with prostate cancer. The results suggest that hMOB3B may act as a tumor suppressor in human prostate cancer.
20423481 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR      1 - 70
INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG     71 - 140
VPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM    141 - 210
TSRMCH                                                                    211 - 216
//

Text Mined References (20)

PMID Year Title
26130958 2015 Lower Levels of Human MOB3B Are Associated with Prostate Cancer Susceptibility and Aggressive Clinicopathological Characteristics.
23376709 2013 A 2-stage genome-wide association study to identify single nucleotide polymorphisms associated with development of urinary symptoms after radiotherapy for prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
20423481 2010 Lack of replication of genetic predictors for the rheumatoid arthritis response to anti-TNF treatments: a prospective case-only study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19060904 2009 An empirical framework for binary interactome mapping.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
More...