Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.98
PubTator Score 7.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 2.99024172174504E-24
lung adenocarcinoma 2714 1.31254415818075E-13
astrocytoma 1493 1.40660085812851E-11
glioblastoma 5572 4.08819461013879E-6
pediatric high grade glioma 2712 4.19372201606366E-6
pilocytic astrocytoma 3086 5.89922057575337E-6
pituitary cancer 1972 1.35666295351644E-5
medulloblastoma, large-cell 6234 2.22810229209661E-5
ependymoma 2514 3.38501582315442E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.03833943419977E-4
ovarian cancer 8492 0.00172534664590135
ductal carcinoma in situ 1745 0.002115517287229
invasive ductal carcinoma 2950 0.00565725290991706
interstitial cystitis 2299 0.010521384955195
primitive neuroectodermal tumor 3031 0.0184672465398359
atypical teratoid / rhabdoid tumor 4369 0.0226053313826751
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0264190857339046
oligodendroglioma 2849 0.0349764036430345
group 3 medulloblastoma 2254 0.0434508979055362
osteosarcoma 7933 0.0448309099854547

Expression

  Differential Expression (20)

Synonym

Accession Q86T96 Q0JSU3 Q495A8 Q8NBD1
Symbols RINES

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26805552 RNF180 is capable of inhibiting lymph node metastasis of gastric cancer by suppressing the intracellular activation of malignant molecular signals.
25769451 hypermethylated CpG site count of E3 ubiquitin ligase Ring finger protein 180 promoter for evaluating the prognosis of gastric cancer was reasonable by using the direct bisulfite sequencing.
24833402 We found that only few methylated CpG sites of RNF180 promoter was appropriate to predict the survival of gastric cancer
22563461 Data indicate that the ring finger protein 180 (RNF180) and HTR1A showed association to T1D in the Swedish and Danish families.
21717426 RNF180 is a novel potential tumor suppressor in gastric carcinogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVWHMNVEALPEW      1 - 70
ISCLIQKAQWTVGKLNCPFCGARLGGFNFVSTPKCSCGQLAAVHLSKSRTDYQPTQAGRLMRPSVKYLSH     71 - 140
PRVQSGCDKEALLTGGGSENRNHRLLNMARNNNDPGRLTEALCLEVRPTYFEMKNEKLLSKASEPKYQLF    141 - 210
VPQLVTGRCATRAFHRKSHSLDLNISEKLTLLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSF    211 - 280
QNPSSFDPSMLLQRFSVAPHETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEE    281 - 350
HLSPLDFLHSANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMTLNNEMSTDED    351 - 420
NEYAEEKDSYICAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPSSTPCPLCRTIISRVFFQTELNNAT    421 - 490
KTFFTKEYLKIKQSFQKSNSAKWPLPSCRKAFHLFGGFRRHAAPVTRRQFPHGAHRMDYLHFEDDSRGWW    491 - 560
FDMDMVIIYIYSVNWVIGFIVFCFLCYFFFPF                                          561 - 592
//

Text Mined References (15)

PMID Year Title
26805552 2016 Clinical and experimental role of ring finger protein 180 on lymph node metastasis and survival in gastric cancer.
25769451 2015 Evaluating the clinical feasibility: The direct bisulfite genomic sequencing for examination of methylated status of E3 ubiquitin ligase RNF180 DNA promoter to predict the survival of gastric cancer.
24833402 2014 Methylation of CpG sites in RNF180 DNA promoter prediction poor survival of gastric cancer.
22563461 2012 HTR1A a novel type 1 diabetes susceptibility gene on chromosome 5p13-q13.
21717426 2012 Characterization of the gene structure, functional significance, and clinical application of RNF180, a novel gene in gastric cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...