Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.14
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.100 1.5e-02
astrocytoma 1.400 1.4e-11
Astrocytoma, Pilocytic 1.800 9.4e-06
atypical teratoid / rhabdoid tumor -1.800 2.3e-02
Breast cancer 2.000 3.8e-02
ductal carcinoma in situ -1.100 2.1e-03
ependymoma 1.200 3.4e-05
glioblastoma 1.200 2.0e-03
group 3 medulloblastoma -1.200 4.3e-02
interstitial cystitis -1.200 1.1e-02
intraductal papillary-mucinous carcinoma... -2.000 5.0e-04
intraductal papillary-mucinous neoplasm ... -1.600 2.6e-02
invasive ductal carcinoma -1.400 5.7e-03
lung adenocarcinoma -1.500 1.3e-13
medulloblastoma, large-cell -1.800 1.3e-04
oligodendroglioma 2.000 3.5e-02
osteosarcoma -1.228 4.5e-02
ovarian cancer -1.100 1.7e-03
pituitary cancer 1.200 1.0e-04
primitive neuroectodermal tumor 1.300 1.8e-02

Gene RIF (7)

AA Sequence

MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVWHMNVEALPEW      1 - 70
ISCLIQKAQWTVGKLNCPFCGARLGGFNFVSTPKCSCGQLAAVHLSKSRTDYQPTQAGRLMRPSVKYLSH     71 - 140
PRVQSGCDKEALLTGGGSENRNHRLLNMARNNNDPGRLTEALCLEVRPTYFEMKNEKLLSKASEPKYQLF    141 - 210
VPQLVTGRCATRAFHRKSHSLDLNISEKLTLLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSF    211 - 280
QNPSSFDPSMLLQRFSVAPHETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEE    281 - 350
HLSPLDFLHSANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMTLNNEMSTDED    351 - 420
NEYAEEKDSYICAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPSSTPCPLCRTIISRVFFQTELNNAT    421 - 490
KTFFTKEYLKIKQSFQKSNSAKWPLPSCRKAFHLFGGFRRHAAPVTRRQFPHGAHRMDYLHFEDDSRGWW    491 - 560
FDMDMVIIYIYSVNWVIGFIVFCFLCYFFFPF                                          561 - 592
//

Text Mined References (16)

PMID Year Title