Property Summary

NCBI Gene PubMed Count 22
Grant Count 7
R01 Count 5
Funding $1,084,198.75
PubMed Score 12.52
PubTator Score 8.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.460 0.000
atypical teratoid / rhabdoid tumor -1.100 0.027
medulloblastoma, large-cell -1.100 0.016
tuberculosis and treatment for 3 months -1.800 0.000
ovarian cancer -1.100 0.000

Gene RIF (9)

PMID Text
26299517 USP37 associates with cohesin and contributes to sister chromatid resolution. Cohesion defects are rescued by expression of an RNAi-resistant USP37, but not the catalytically impaired USP37(C350A) mutant.
25284584 USP37 is significantly upregulated in human lung cancer tissues, where its expression is positively correlated with c-Myc protein expression.
24324262 These results suggested that the UIMs in USP37 contribute to the full enzymatic activity, but not ubiquitin chain substrate specificity, of USP37 possibly by holding the ubiquitin chain substrate in the proximity of the catalytic core.
23208507 our findings of USP37-modulating PLZF/RARA stability and cell transformation suggest that USP37 is a potential therapeutic target for PLZF/RARA-associated APL
23027877 Skp1-Cul1-F-box ubiquitin ligase (SCF(betaTrCP))-mediated destruction of the ubiquitin-specific protease USP37 during G2-phase promotes mitotic entry
22665064 USP37 links REST to the control of p27 stability and cell proliferation.
21596315 The deubiquitinase USP37 binds CDH1 and removes degradative polyubiquitin from cyclin A. USP37 was induced by E2F factors in G1, peaked at G1/S, and was degraded in late mitosis. Phosphorylation of USP37 by CDK2 stimulated its full activity.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNVVLRPSGAKQS      1 - 70
RLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSRQLSYS     71 - 140
DNQASAKRGSLETKDDIPFRKVLGNPGRGSIKTVAGSGIARTIPSLTSTSTPLRSGLLENRTEKRKRMIS    141 - 210
TGSELNEDYPKENDSSSNNKAMTDPSRKYLTSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRAGSKEHS    211 - 280
SGGTNLDRTNVSSQTPSAKRSLGFLPQPVPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTC    281 - 350
YMNAILQSLFSLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATAER    351 - 420
FSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVSGEENSPDISATRAYTCPVITNLEFEVQHSIICK    421 - 490
ACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSCEKCGGKCALVRHKFNRLPRVLI    491 - 560
LHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENTKPPFTLGWSAHMAISRPLKASQMVNSCITSPS    561 - 630
TPSKKFTFKSKSSLALCLDSDSEDELKRSVALSQRLCEMLGNEQQQEDLEKDSKLCPIEPDKSELENSGF    631 - 700
DRMSEEELLAAVLEISKRDASPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDTMETEKPKTITELDPAS    701 - 770
FTEITKDCDENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATELS    771 - 840
LQEFNNSFVDALGSDEDSGNEDVFDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHIGSTSSSGHYISD    841 - 910
VYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIFFYMHKEIFDELLETEKNSQSLSTEVGKTTRQAL     911 - 979
//

Text Mined References (28)

PMID Year Title
26299517 2015 The Deubiquitinase USP37 Regulates Chromosome Cohesion and Mitotic Progression.
25284584 2015 USP37 directly deubiquitinates and stabilizes c-Myc in lung cancer.
24324262 2014 Ubiquitin-interacting motifs confer full catalytic activity, but not ubiquitin chain substrate specificity, to deubiquitinating enzyme USP37.
23208507 2013 The deubiquitinating enzyme USP37 regulates the oncogenic fusion protein PLZF/RARA stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027877 2012 Skp1-Cul1-F-box ubiquitin ligase (SCF(?TrCP))-mediated destruction of the ubiquitin-specific protease USP37 during G2-phase promotes mitotic entry.
22665064 2013 The deubiquitylase USP37 links REST to the control of p27 stability and cell proliferation.
21596315 2011 Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
More...