Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.13
PubTator Score 4.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
non-small cell lung cancer 2798 9.16882015697461E-15
cystic fibrosis 1670 9.70953440308672E-8
atypical teratoid/rhabdoid tumor 1095 1.99976260165545E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.11395928390622E-5
breast carcinoma 1614 3.17731280485839E-5
malignant mesothelioma 3163 5.55664446209089E-5
pilocytic astrocytoma 3086 1.32867593800883E-4
ductal carcinoma in situ 1745 2.36059467586346E-4
invasive ductal carcinoma 2950 2.97352346569201E-4
group 3 medulloblastoma 2254 4.08819563081668E-4
Breast cancer 3099 0.00155016765187576
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00255523315704035
psoriasis 6685 0.00287934092106831
Down syndrome 548 0.00363265653127683
pediatric high grade glioma 2712 0.00373556725334079
lung cancer 4473 0.004428595371319
colon cancer 1475 0.00630155678161311
subependymal giant cell astrocytoma 2287 0.0066227937584762
primitive neuroectodermal tumor 3031 0.00828404753099984
glioblastoma 5572 0.00993714313142573
adrenocortical carcinoma 1427 0.0155827692301309
fibroadenoma 557 0.0243144128344362
mucosa-associated lymphoid tissue lymphoma 480 0.0298714135539353
medulloblastoma, large-cell 6234 0.0355620425128135
sarcoidosis 368 0.045496311845519
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0
Disease Target Count Z-score Confidence
Chondrosarcoma 24 3.53 1.8

Expression

Synonym

Accession Q86T65 G5EA45 Q5T4T8 Q5T4U0 Q9NQI5 Q9Y4G0
Symbols dJ90A20A.1

Gene

  Ortholog (12)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
24223803 miR-335 regulates the expression of at least five formin family members, three of which are validated, FMNL3, FMN2 and DAAM2.
19562778 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMF      1 - 70
ALPPEKKWQIYCSKKKEQEDPNKLATSWPDYYIDRINSMAAMQSLYAFDEEETEMRNQVVEDLKTALRTQ     71 - 140
PMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEAISTIAQSLRT    141 - 210
ENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSF    211 - 280
INAVLNAGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDMVH    281 - 350
IDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGVDPDL    351 - 420
APLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKERECETKTLEKEEMMRTLNKMKDKL    421 - 490
ARESQELRQARGQVAELVAQLSELSTGPVSSPPPPGGPLTLSSSMTTNDLPPPPPPLPFACCPPPPPPPL    491 - 560
PPGGPPTPPGAPPCLGMGLPLPQDPYPSSDVPLRKKRVPQPSHPLKSFNWVKLNEERVPGTVWNEIDDMQ    561 - 630
VFRILDLEDFEKMFSAYQRHQKELGSTEDIYLASRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRQAIL    631 - 700
KMDEQEDLAKDMLEQLLKFIPEKSDIDLLEEHKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQE    701 - 770
RLAEAKPKVEAILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLNKIADTKSSIDRNIS    771 - 840
LLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPSDKFV    841 - 910
PVMSDFITVSSFSFSELEDQLNEARDKFAKALMHFGEHDSKMQPDEFFGIFDTFLQAFSEARQDLEAMRR    911 - 980
RKEEEERRARMEAMLKEQRERERWQRQRKVLAAGSSLEEGGEFDDLVSALRSGEVFDKDLCKLKRSRKRS    981 - 1050
GSQALEVTRERAINRLNY                                                       1051 - 1068
//

Text Mined References (13)

PMID Year Title
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223803 2013 Metastasis suppressor microRNA-335 targets the formin family of actin nucleators.
20010834 2010 Genome-wide association study identifies five loci associated with lung function.
19562778 2009 Wnt antagonist gene polymorphisms and renal cancer.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12632087 2003 Identification and characterization of human DAAM2 gene in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...