Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.13
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -1.733 1.6e-02
Astrocytoma, Pilocytic -1.500 1.2e-04
atypical teratoid / rhabdoid tumor -1.500 2.3e-04
Breast cancer -1.500 1.6e-03
breast carcinoma -1.600 3.2e-05
colon cancer -1.300 6.3e-03
cystic fibrosis -3.099 9.7e-08
Down syndrome 1.200 3.6e-03
ductal carcinoma in situ -1.600 2.4e-04
fibroadenoma -1.300 2.4e-02
glioblastoma -1.200 9.9e-03
group 3 medulloblastoma -2.500 4.1e-04
intraductal papillary-mucinous carcinoma... -1.500 3.1e-05
intraductal papillary-mucinous neoplasm ... -1.200 2.6e-03
invasive ductal carcinoma -2.400 3.0e-04
lung cancer -1.200 4.4e-03
malignant mesothelioma 1.200 5.6e-05
medulloblastoma, large-cell -1.100 3.6e-02
mucosa-associated lymphoid tissue lympho... 1.340 3.0e-02
non-small cell lung cancer -1.469 9.2e-15
pediatric high grade glioma -1.700 3.7e-03
primitive neuroectodermal tumor -1.400 8.3e-03
psoriasis -1.400 2.9e-03
sarcoidosis 1.100 4.5e-02
subependymal giant cell astrocytoma -2.954 6.6e-03

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMF      1 - 70
ALPPEKKWQIYCSKKKEQEDPNKLATSWPDYYIDRINSMAAMQSLYAFDEEETEMRNQVVEDLKTALRTQ     71 - 140
PMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEAISTIAQSLRT    141 - 210
ENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSF    211 - 280
INAVLNAGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDMVH    281 - 350
IDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGVDPDL    351 - 420
APLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKERECETKTLEKEEMMRTLNKMKDKL    421 - 490
ARESQELRQARGQVAELVAQLSELSTGPVSSPPPPGGPLTLSSSMTTNDLPPPPPPLPFACCPPPPPPPL    491 - 560
PPGGPPTPPGAPPCLGMGLPLPQDPYPSSDVPLRKKRVPQPSHPLKSFNWVKLNEERVPGTVWNEIDDMQ    561 - 630
VFRILDLEDFEKMFSAYQRHQKELGSTEDIYLASRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRQAIL    631 - 700
KMDEQEDLAKDMLEQLLKFIPEKSDIDLLEEHKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQE    701 - 770
RLAEAKPKVEAILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLNKIADTKSSIDRNIS    771 - 840
LLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPSDKFV    841 - 910
PVMSDFITVSSFSFSELEDQLNEARDKFAKALMHFGEHDSKMQPDEFFGIFDTFLQAFSEARQDLEAMRR    911 - 980
RKEEEERRARMEAMLKEQRERERWQRQRKVLAAGSSLEEGGEFDDLVSALRSGEVFDKDLCKLKRSRKRS    981 - 1050
GSQALEVTRERAINRLNY                                                       1051 - 1068
//

Text Mined References (14)

PMID Year Title