Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.5e-03
tuberculosis 2010 4.9e-03
adrenocortical carcinoma 1428 5.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Large intestine cancer 126 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma 1.107 5.0e-03
group 3 medulloblastoma 1.200 1.5e-03
tuberculosis 1.100 4.9e-03

AA Sequence

MIQSQISFEDVAVDFTLEEWQLLNPTQKNLYRDVMLENYSNLVFLEVWLDNPKMWLRDNQDNLKSMERGH      1 - 70
KYDVFGKIFNSSINIVHVGLRSHKCGTGEKSLKCPFDLLIPKNNCERKKIDELNKKLLFCIKPGRTHGGI     71 - 140
KYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRFFNKKSQLVIHQRTHTGEKPYQCSECGKAFSQKS    141 - 210
LLTVHQRTHSGEKPHGCSECQKAFSRKSLLILHQRIHTGEKPYGCSECGKAFSRKSQLKRHQITHTIEKP    211 - 280
YSCSECGKAFSQKLKLITHQRAHTGEKPYPCSHCGKAFFWKSQLITHQRTHTGKKPYGCGECQKAFSRNS    281 - 350
LLIRHQRIHTGEKPYECNECGEAFIRKPQLIKHQITHTGEKNYRCSDCEEAFFKKSELIRHQKIHLGEKP    351 - 420
YGCIQCGKTFFGKSQLLTHHRTHTGEKPYECSECGKAFTQKSSLISHQRTHTGEKPYECSECRKTFSEKS    421 - 490
SLIHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRIHTGEKPYECSECGKAFVQKVQLIKHQRNHTGEKT    491 - 560
YGCSDCAKAFFEKAQLIIHQRIHTGERPYKCGECGKSFTRKSHLMRHQRIHTGDKYYGCNECGTTFNRKS    561 - 630
QLMIHQRNHII                                                               631 - 641
//

Text Mined References (5)

PMID Year Title