| Tbio | Transcriptional regulator Kaiso |
Transcriptional regulator with bimodal DNA-binding specificity. Binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' and also binds to the non-methylated consensus sequence 5'-CTGCNA-3' also known as the consensus kaiso binding site (KBS). Recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. May contribute to the repression of target genes of the Wnt signaling pathway. May also activate transcription of a subset of target genes by the recruitment of CTNND2. Represses expression of MMP7 in conjunction with transcriptional corepressors CBFA2T3, CBFA2T2 and RUNX1T1 (PubMed:23251453).
This gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-α2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, May 2010]
This gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-α2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, May 2010]
Comments
| Disease | log2 FC | p |
|---|---|---|
| medulloblastoma, large-cell | 1.300 | 0.000 |
| juvenile dermatomyositis | 1.053 | 0.000 |
| ovarian cancer | 1.200 | 0.015 |
| PMID | Text |
|---|---|
| 26514431 | Kaiso modulates HIF1A gene expression by binding to the methylated HIF1A promoter in a region proximal to the autoregulatory HIF-1 binding site, primarily during hypoxia. |
| 26183023 | NF-kappaB response element, located close to the p53RE#1, mediates APAF1 transcriptional repression by affecting interaction between KAISO and p53 |
| 25288747 | KAISO is a regulator of p53-mediated transcription of CDKN1A and apoptotic genes |
| 24570268 | Nuclear localization of Kaiso promotes the poorly differentiated phenotype and EMT in infiltrating ductal carcinomas. |
| 24498333 | Data indicate that Kaiso protein participates in the regulation of beta-catenin mRNA expression by interacting with p120-catenin in the lung cancer cell lines. |
| 24474278 | The optimized knockdown with p120 and Kaiso siRNAs further expands the size of HCEC monolayers without endothelial mesenchymal transition (EMT) via selective activation of p120/Kaiso signaling that requires the RhoA-ROCK-noncanonical BMP-NFkB signaling. |
| 23888785 | Transcription factor Kaiso does not interact with hydroxymethylated DNA within CTGCNA sequence context |
| 23251453 | presence of MTG16 in this complex, and its contributions to transcriptional repression both required Kaiso binding to its binding site on DNA, establishing MTG16-Kaiso binding as functionally relevant in Kaiso-dependent transcriptional repression |
| 23226276 | Kaiso represses the cell cycle gene cyclin D1 via sequence-specific and methyl-CpG-dependent mechanism. |
| 22974583 | These findings establish a defined oncogenic role of Kaiso in promoting the progression of prostate cancer. |
| More... |
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQLFSVAGQVVEL 1 - 70 SFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTAQDGNTEPLPP 71 - 140 DSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPS 141 - 210 NNTVAQVQSNPGPVAISDVAPSASNNSPPLTNITPTQKLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNI 211 - 280 ILLNQTPLSTPPNVSSSLPNHMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAV 281 - 350 SNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDT 351 - 420 ATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKHDDHYELIVDG 421 - 490 RVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFI 491 - 560 NYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTT 561 - 630 TSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY 631 - 672 //
| PMID | Year | Title |
|---|---|---|
| 26514431 | 2015 | Methylation-dependent regulation of hypoxia inducible factor-1 alpha gene expression by the transcription factor Kaiso. |
| 26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
| 26183023 | 2015 | Transcriptional activation of APAF1 by KAISO (ZBTB33) and p53 is attenuated by RelA/p65. |
| 25288747 | 2014 | KAISO, a critical regulator of p53-mediated transcription of CDKN1A and apoptotic genes. |
| 25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
| 24570268 | 2014 | Nuclear localization of Kaiso promotes the poorly differentiated phenotype and EMT in infiltrating ductal carcinomas. |
| 24498333 | 2014 | Kaiso interacts with p120-catenin to regulate ?-catenin expression at the transcriptional level. |
| 24474278 | 2014 | Knockdown of both p120 catenin and Kaiso promotes expansion of human corneal endothelial monolayers via RhoA-ROCK-noncanonical BMP-NF?B pathway. |
| 23888785 | [Transcription factor Kaiso does not interact with hydroxymethylated DNA within CTGCNA sequence context]. | |
| 23251453 | 2012 | Kaiso directs the transcriptional corepressor MTG16 to the Kaiso binding site in target promoters. |
| More... |
