Property Summary

NCBI Gene PubMed Count 51
PubMed Score 2.73
PubTator Score 24.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
juvenile dermatomyositis 1.053 0.000
ovarian cancer 1.200 0.015

Synonym

Accession Q86T24 B2R5U6 O00319 Q7Z361 Q8IVP6 Q8N3P0
Symbols ZNF348
ZNF-kaiso

Gene

PDB

2LT7   3FKC   3M4T   3M8V   4F6M   4F6N  

Gene RIF (33)

PMID Text
26514431 Kaiso modulates HIF1A gene expression by binding to the methylated HIF1A promoter in a region proximal to the autoregulatory HIF-1 binding site, primarily during hypoxia.
26183023 NF-kappaB response element, located close to the p53RE#1, mediates APAF1 transcriptional repression by affecting interaction between KAISO and p53
25288747 KAISO is a regulator of p53-mediated transcription of CDKN1A and apoptotic genes
24570268 Nuclear localization of Kaiso promotes the poorly differentiated phenotype and EMT in infiltrating ductal carcinomas.
24498333 Data indicate that Kaiso protein participates in the regulation of beta-catenin mRNA expression by interacting with p120-catenin in the lung cancer cell lines.
24474278 The optimized knockdown with p120 and Kaiso siRNAs further expands the size of HCEC monolayers without endothelial mesenchymal transition (EMT) via selective activation of p120/Kaiso signaling that requires the RhoA-ROCK-noncanonical BMP-NFkB signaling.
23888785 Transcription factor Kaiso does not interact with hydroxymethylated DNA within CTGCNA sequence context
23251453 presence of MTG16 in this complex, and its contributions to transcriptional repression both required Kaiso binding to its binding site on DNA, establishing MTG16-Kaiso binding as functionally relevant in Kaiso-dependent transcriptional repression
23226276 Kaiso represses the cell cycle gene cyclin D1 via sequence-specific and methyl-CpG-dependent mechanism.
22974583 These findings establish a defined oncogenic role of Kaiso in promoting the progression of prostate cancer.
More...

AA Sequence

MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQLFSVAGQVVEL      1 - 70
SFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTAQDGNTEPLPP     71 - 140
DSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPS    141 - 210
NNTVAQVQSNPGPVAISDVAPSASNNSPPLTNITPTQKLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNI    211 - 280
ILLNQTPLSTPPNVSSSLPNHMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAV    281 - 350
SNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDT    351 - 420
ATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKHDDHYELIVDG    421 - 490
RVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFI    491 - 560
NYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTT    561 - 630
TSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY                                631 - 672
//

Text Mined References (55)

PMID Year Title
26514431 2015 Methylation-dependent regulation of hypoxia inducible factor-1 alpha gene expression by the transcription factor Kaiso.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26183023 2015 Transcriptional activation of APAF1 by KAISO (ZBTB33) and p53 is attenuated by RelA/p65.
25288747 2014 KAISO, a critical regulator of p53-mediated transcription of CDKN1A and apoptotic genes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24570268 2014 Nuclear localization of Kaiso promotes the poorly differentiated phenotype and EMT in infiltrating ductal carcinomas.
24498333 2014 Kaiso interacts with p120-catenin to regulate ?-catenin expression at the transcriptional level.
24474278 2014 Knockdown of both p120 catenin and Kaiso promotes expansion of human corneal endothelial monolayers via RhoA-ROCK-noncanonical BMP-NF?B pathway.
23888785 [Transcription factor Kaiso does not interact with hydroxymethylated DNA within CTGCNA sequence context].
23251453 2012 Kaiso directs the transcriptional corepressor MTG16 to the Kaiso binding site in target promoters.
More...