Property Summary

NCBI Gene PubMed Count 57
PubMed Score 61.61
PubTator Score 24.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.2e-10
medulloblastoma, large-cell 6241 8.1e-05
ovarian cancer 8520 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.111 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.053 1.2e-10
medulloblastoma, large-cell 1.300 8.1e-05
ovarian cancer 1.200 1.5e-02

Gene RIF (39)

AA Sequence

MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQLFSVAGQVVEL      1 - 70
SFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTAQDGNTEPLPP     71 - 140
DSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPS    141 - 210
NNTVAQVQSNPGPVAISDVAPSASNNSPPLTNITPTQKLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNI    211 - 280
ILLNQTPLSTPPNVSSSLPNHMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAV    281 - 350
SNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDT    351 - 420
ATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKHDDHYELIVDG    421 - 490
RVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFI    491 - 560
NYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTT    561 - 630
TSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY                                631 - 672
//

Text Mined References (62)

PMID Year Title