Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 3.2e-07
group 4 medulloblastoma -1.200 6.5e-06
medulloblastoma, large-cell -1.900 1.2e-06
posterior fossa group B ependymoma -1.200 2.4e-08
Rheumatoid arthritis -1.100 3.9e-03

Gene RIF (4)

AA Sequence

MYRRKSGWTGCAITCSPCTAMTQLRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPH      1 - 70
PSEPGVLDCLGPCHLLPLLSPGSPCWVLGLHFSLHPPSAASASHALTITSLPPGLLPFVGVELTAHPQAL     71 - 140
MGRGFPSGMGAAGRHLCFL                                                       141 - 159
//

Text Mined References (13)

PMID Year Title