Property Summary

NCBI Gene PubMed Count 14
PubMed Score 23.97
PubTator Score 19.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Intermediate coronary syndrome 11 0.0 1.7
Disease Target Count Z-score Confidence
Uterine carcinosarcoma 3 3.295 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.400 2.3e-04
facioscapulohumeral dystrophy 2.500 8.1e-04
invasive ductal carcinoma -1.200 8.2e-04
lung adenocarcinoma -1.400 2.0e-16
lung carcinoma -1.200 4.6e-06
non-small cell lung cancer -2.178 3.6e-26

Gene RIF (6)

AA Sequence

MRPAFALCLLWQALWPGPGGGEHPTADRAGCSASGACYSLHHATMKRQAAEEACILRGGALSTVRAGAEL      1 - 70
RAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTA     71 - 140
RRCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGT    141 - 210
EVSALCRGQLPISVTCIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELG    211 - 280
KDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWG    281 - 350
SQSTMSTLQMSLQAESKATITPSGSVISKFNSTTSSATPQAFDSSSAVVFIFVSTAVVVLVILTMTVLGL    351 - 420
VKLCFHESPSSQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALLAESPLGSSDA    421 - 490
//

Text Mined References (16)

PMID Year Title