Property Summary

NCBI Gene PubMed Count 13
Grant Count 3
R01 Count 3
Funding $542,359
PubMed Score 22.54
PubTator Score 19.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
non-small cell lung cancer -2.178 0.000
breast carcinoma -1.400 0.000
lung adenocarcinoma -3.400 0.000
lung carcinoma -1.200 0.000
invasive ductal carcinoma -1.200 0.001
facioscapulohumeral dystrophy 2.500 0.001

Synonym

Accession Q86T13 Q695G9 Q6PWT6 Q8N5V5
Symbols CEG1
EGFR-5
C14orf27

Gene

Gene RIF (5)

PMID Text
25745997 Results suggest that CLEC14A-MMRN2 binding has a role in inducing sprouting angiogenesis during tumor growth, which has the potential to be manipulated in future antiangiogenic therapy design.
25745997 The CLEC14A-MMRN2 interaction is involved in sprouting angiogenesis. Disrupting this interaction with monoclonal antibodies directed against CLEC14A show anti-angiogenic and anti-tumor effects.
23979707 CLEC14A is a matrix component which binds to MMRN2 in the process of endothelial cells transformation in tumor angiogenesis.
23644659 clec14a-CTLD may be a key domain in angiogenesis
21706054 In this study, they identify and characterize a novel tumor endothelial marker, CLEC14A, which has properties that suggest it is a candidate for tumor vascular targeting and anti-angiogenic approaches.

AA Sequence

MRPAFALCLLWQALWPGPGGGEHPTADRAGCSASGACYSLHHATMKRQAAEEACILRGGALSTVRAGAEL      1 - 70
RAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTA     71 - 140
RRCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGT    141 - 210
EVSALCRGQLPISVTCIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELG    211 - 280
KDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWG    281 - 350
SQSTMSTLQMSLQAESKATITPSGSVISKFNSTTSSATPQAFDSSSAVVFIFVSTAVVVLVILTMTVLGL    351 - 420
VKLCFHESPSSQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALLAESPLGSSDA    421 - 490
//

Text Mined References (15)

PMID Year Title
25745997 2015 Blocking CLEC14A-MMRN2 binding inhibits sprouting angiogenesis and tumour growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23644659 2013 Human antibodies targeting the C-type lectin-like domain of the tumor endothelial cell marker clec14a regulate angiogenic properties in vitro.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22103489 2011 Shear stress, tip cells and regulators of endothelial migration.
21706054 2012 Identification and angiogenic role of the novel tumor endothelial marker CLEC14A.
21095181 2011 Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion.
15636369 2004 [Cloning and characterization of a novel human ceg1 gene cDNA].
More...