Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.16
PubTator Score 2.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lung mucoepidermoid carcinoma 1 5.209 2.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 4.7e-05

Gene RIF (4)

AA Sequence

MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVLPGEDPPPYSP      1 - 70
LTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNCLLICKVTSQRI     71 - 140
ACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRK    141 - 210
RCICCFLLGLLLAVTATGLAFGTWKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS       211 - 277
//

Text Mined References (12)

PMID Year Title