Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
R01 Count 4
Funding $1,533,008
PubMed Score 2.98
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q86SZ2 B3KPS2 Q5JPD6 Q86U35 Q86X35
Symbols TPC6

Gene

PDB

2CFH   3KXC   2BJN  

AA Sequence

MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICK      1 - 70
DFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVT     71 - 140
AEVSSMPACKFQVMIQKL                                                        141 - 158
//

Text Mined References (9)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
18930054 2008 Distinct isocomplexes of the TRAPP trafficking factor coexist inside human cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16697553 2006 A mouse TRAPP-related protein is involved in pigmentation.
16025134 2005 The structure of the TRAPP subunit TPC6 suggests a model for a TRAPP subcomplex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.