Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.07
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 3.4e-02
astrocytic glioma -1.200 1.0e-02
atypical teratoid / rhabdoid tumor -1.700 1.7e-06
ependymoma -1.500 1.1e-02
gastric cancer 1.200 3.7e-03
glioblastoma -1.700 7.1e-07
hepatocellular carcinoma 1.200 1.5e-05
intraductal papillary-mucinous neoplasm ... 1.900 2.3e-02
juvenile dermatomyositis 1.157 1.5e-10
medulloblastoma, large-cell -1.400 2.8e-04
osteosarcoma -1.022 1.1e-02
ovarian cancer 1.500 5.2e-03
Pick disease -1.300 1.2e-02
primitive neuroectodermal tumor -1.100 6.1e-04
tuberculosis and treatment for 6 months -1.200 9.2e-04

AA Sequence

MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICK      1 - 70
DFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVT     71 - 140
AEVSSMPACKFQVMIQKL                                                        141 - 158
//

Text Mined References (10)

PMID Year Title