Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q86SY8
Symbols MYCLo-3
C14orf33

Gene

 Compartment GO Term (1)

AA Sequence

MEAAGGFQVHFHPSNGDGRFIETSSAADLEVISYSSKVSVTERCFIKVCTVLF                       1 - 53
//

Text Mined References (2)

PMID Year Title