Property Summary

NCBI Gene PubMed Count 15
PubMed Score 74.90
PubTator Score 15.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 3.000 3.5e-02
lung cancer 1.100 8.2e-04
non primary Sjogren syndrome sicca 1.200 1.9e-02
osteosarcoma -2.241 1.2e-04

Gene RIF (8)

AA Sequence

MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFS      1 - 70
NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKK     71 - 140
LGIHSALLDEKKDQDSK                                                         141 - 157
//

Text Mined References (21)

PMID Year Title