Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.57
PubTator Score 9.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.300 9.7e-05
breast carcinoma 2.000 2.6e-02
ductal carcinoma in situ 1.800 4.4e-04
interstitial cystitis -1.600 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 9.9e-04
invasive ductal carcinoma 1.800 1.3e-03
lung carcinoma 1.300 5.4e-25
medulloblastoma, large-cell 1.300 2.7e-04
Multiple Sclerosis -2.600 1.4e-05
ovarian cancer 1.400 1.4e-09
psoriasis -1.300 4.1e-66
ulcerative colitis -1.200 1.1e-04

Protein-protein Interaction (4)

Gene RIF (11)

AA Sequence

MAWPKLPAPWLLLCTWLPAGCLSLLVTVQHTERYVTLFASIILKCDYTTSAQLQDVVVTWRFKSFCKDPI      1 - 70
FDYYSASYQAALSLGQDPSNDCNDNQREVRIVAQRRGQNEPVLGVDYRQRKITIQNRADLVINEVMWWDH     71 - 140
GVYYCTIEAPGDTSGDPDKEVKLIVLHWLTVIFIILGALLLLLLIGVCWCQCCPQYCCCYIRCPCCPAHC    141 - 210
CCPEEALARHRYMKQAQALGPQMMGKPLYWGADRSSQVSSYPMHPLLQRDLSLPSSLPQMPMTQTTNQPP    211 - 280
IANGVLEYLEKELRNLNLAQPLPPDLKGRFGHPCSMLSSLGSEVVERRIIHLPPLIRDLSSSRRTSDSLH    281 - 350
QQWLTPIPSRPWDLREGRSHHHYPDFHQELQDRGPKSWALERRELDPSWSGRHRSSRLNGSPIHWSDRDS    351 - 420
LSDVPSSSEARWRPSHPPFRSRCQERPRRPSPRESTQRHGRRRRHRSYSPPLPSGLSSWSSEEDKERQPQ    421 - 490
SWRAHRRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVVI                  491 - 546
//

Text Mined References (17)

PMID Year Title