Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $160,463
PubMed Score 7.63
PubTator Score 11.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86SR1 B3KXC9 Q6IN56 Q86VP8 Q8IXJ2 Q8TEJ2 Q96IV2 Q9H8E1 Q9Y4M4
Symbols GALNACT10
PPGALNACT10
PPGANTASE10

Gene

PANTHER Protein Class (2)

PDB

2D7I   2D7R  

Gene RIF (7)

PMID Text
25898001 SNPs in LEKR1 and GALNT10 modulate sex-difference in carotid intima-media thickness.
25422324 our results reveal a novel Hnf4alpha/miR-122/GALNT10 regulatory pathway that facilitates EGF miR-122 activation and hepatoma growth in HBV-associated hepatocarcinogenesis.
25391266 Elevated Expression of N-Acetylgalactosaminyltransferase 10 is associated with early Recurrence of Patients with Clear-Cell Renal Cell Carcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460755 GalNAc T10 has a large and pronounced glycopeptide preference for Ser/Thr-O-GalNAc only at the +1 position from the acceptor site, whereas T1 and T2 have significantly reduced and variable preferences for Ser/Thr-O-GalNAc.
18562306 sequence recognition by the catalytic domain differs between hT2 and hT10 in that hT10 requires a pre-existing GalNAc residue while hT2 does not
12417297 Molecular cloning and characterization of pp-GalNAc-T10 as a UDP-GalNAc transferase.

AA Sequence

MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQK      1 - 70
LKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRY     71 - 140
LETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILR    141 - 210
TKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQA    211 - 280
GDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEIS    281 - 350
FKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV    351 - 420
AVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVR    421 - 490
GRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVS    491 - 560
GSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN                               561 - 603
//

Text Mined References (18)

PMID Year Title
25898001 2015 Genetic variants in LEKR1 and GALNT10 modulate sex-difference in carotid intima-media thickness: a genome-wide interaction study.
25422324 2015 Decreased expression of hepatocyte nuclear factor 4? (Hnf4?)/microRNA-122 (miR-122) axis in hepatitis B virus-associated hepatocellular carcinoma enhances potential oncogenic GALNT10 protein activity.
25391266 2015 Elevated Expression of N-Acetylgalactosaminyltransferase 10 Predicts Poor Survival and Early Recurrence of Patients with Clear-Cell Renal Cell Carcinoma.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23583978 2013 A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry.
21701570 2012 Genome-wide association of BMI in African Americans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19460755 2009 Glycopeptide-preferring polypeptide GalNAc transferase 10 (ppGalNAc T10), involved in mucin-type O-glycosylation, has a unique GalNAc-O-Ser/Thr-binding site in its catalytic domain not found in ppGalNAc T1 or T2.
More...