Property Summary

NCBI Gene PubMed Count 19
PubMed Score 731.14
PubTator Score 36.89

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (10)

AA Sequence

MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGI      1 - 70
LEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQ     71 - 140
ATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEV    141 - 210
RLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQ    211 - 280
LLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA                     281 - 333
//

Text Mined References (20)

PMID Year Title