Property Summary

NCBI Gene PubMed Count 30
Grant Count 4
Funding $379,157.6
PubMed Score 14.85
PubTator Score 9.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.590 0.000
group 3 medulloblastoma 2.300 0.004
atypical teratoid / rhabdoid tumor -1.200 0.000
tuberculosis 1.700 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q86SQ7 O60527 Q3ZCR6 Q8N5F2 Q9P0F1
Symbols BBS16
CCCAP
SLSN7
NPHP10
hCCCAP
HSPC085
NY-CO-8
CCCAP SLSN7

Gene

Gene RIF (12)

PMID Text
24157943 Variants in NPHS2, SDCCAG8 and near BMP4 appear to interact with APOL1 to modulate the risk for non-diabetic end stage kidney disease in african americans.
22626039 Our results and prior literature suggest that SDCCAG8 could play an important role in presumed Bardet-Biedl syndrome (BBS) patients affected with severe kidney disease and absent polydactyly.
22614287 significant associations in schizophrenia to SDCAAG8 and extensive replication of associations reported by the Schizophrenia.
22190034 HIV-1 MA is identified to have a physical interaction with serologically defined colon cancer antigen 8 (SDCCAG8) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22095114 Intronic variants of SDCCAG8, which are associated with early onset obesity, are associated with reduced weight loss after a 1-year lifestyle intervention in overweight children and adolescents even after adjusting for age, sex, baseline measurement.
20835237 Mutation of SDCCAG8 is associated with retinal-renal ciliopathy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20421936 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNEDARTAWPELQQ      1 - 70
SHAVNQLKDLLRQQADKESEVSPSRRRKMSPLRSLEHEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCK     71 - 140
EELSGMKNKIQVVVLENEGLQQQLKSQRQEETLREQTLLDASGNMHNSWITTGEDSGVGETSKRPFSHDN    141 - 210
ADFGKAASAGEQLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVG    211 - 280
GLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEA    281 - 350
NFEKTKALIQCDQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKEREYMGSKMLILSQNIAQLEA    351 - 420
QVEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKTNMEKDEAEKEHREFRAKTNRDLEIKD    421 - 490
QEIEKLRIELDESKQHLEQEQQKAALAREECLRLTELLGESEHQLHLTRQEKDSIQQSFSKEAKAQALQA    491 - 560
QQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKEECCTLAKKLEQISQKTRSEIAQLSQEKRY    561 - 630
TYDKLGKLQRRNEELEEQCVQHGRVHETMKQRLRQLDKHSQATAQQLVQLLSKQNQLLLERQSLSEEVDR    631 - 700
LRTQLPSMPQSDC                                                             701 - 713
//

Text Mined References (29)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24166486 2013 GWAS meta analysis identifies TSNARE1 as a novel Schizophrenia / Bipolar susceptibility locus.
24157943 2014 Gene-gene interactions in APOL1-associated nephropathy.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940612 2012 FAM161A, associated with retinitis pigmentosa, is a component of the cilia-basal body complex and interacts with proteins involved in ciliopathies.
22626039 2012 Mutational analysis of SDCCAG8 in Bardet-Biedl syndrome patients with renal involvement and absent polydactyly.
22614287 2013 Genome-wide significant associations in schizophrenia to ITIH3/4, CACNA1C and SDCCAG8, and extensive replication of associations reported by the Schizophrenia PGC.
More...