Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.50
PubTator Score 2.96

Knowledge Summary

Patent (712)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma multiforme -1.100 0.000
posterior fossa group A ependymoma -2.300 0.000
group 4 medulloblastoma -2.800 0.000
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.400 0.000
adult high grade glioma -1.500 0.002
psoriasis -1.500 0.000

Gene RIF (3)

PMID Text
18682798 Observational study of gene-disease association. (HuGE Navigator)
17212699 Studies indicate that the orthologs of GP123 in mouse and rat play a role in the regulation of neuronal signaling pathways.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFCFHAALTFTVF      1 - 70
AGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCLDTDQPPYPRQPLLRFYLVSG     71 - 140
GVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFYGPAAIITLVTCVYFLGTYVQLRRHPGRRYE    141 - 210
LRTQPEEQRRLATPEGGRGIRPGTPPAHDAPGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQG    211 - 280
HFLDMVFSCLYGAFCVTLGLFVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLG    281 - 350
QPRGFAHPPGPCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR    351 - 420
TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGSDGS    421 - 490
PALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLPFGTDGTGNIRTGPWKNETTV    491 - 560
//

Text Mined References (15)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24194939 2013 Unique transcriptome patterns of the white and grey matter corroborate structural and functional heterogeneity in the human frontal lobe.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17212699 2007 The evolutionary history and tissue mapping of GPR123: specific CNS expression pattern predominantly in thalamic nuclei and regions containing large pyramidal cells.
17056209 2007 Identification of novel splice variants of Adhesion G protein-coupled receptors.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
More...