Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.00
PubTator Score 2.96

Knowledge Summary

Patent (712)

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.500 2.1e-03
atypical teratoid / rhabdoid tumor -1.900 1.2e-05
ependymoma -1.700 5.7e-05
glioblastoma multiforme -1.100 2.8e-16
group 3 medulloblastoma -2.300 6.2e-05
medulloblastoma, large-cell -2.400 5.2e-05
psoriasis -1.500 5.2e-05

Gene RIF (3)

AA Sequence

MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFCFHAALTFTVF      1 - 70
AGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCLDTDQPPYPRQPLLRFYLVSG     71 - 140
GVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFYGPAAIITLVTCVYFLGTYVQLRRHPGRRYE    141 - 210
LRTQPEEQRRLATPEGGRGIRPGTPPAHDAPGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQG    211 - 280
HFLDMVFSCLYGAFCVTLGLFVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLG    281 - 350
QPRGFAHPPGPCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR    351 - 420
TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGSDGS    421 - 490
PALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLPFGTDGTGNIRTGPWKNETTV    491 - 560
//

Text Mined References (15)

PMID Year Title