Property Summary

NCBI Gene PubMed Count 36
Grant Count 20
R01 Count 14
Funding $3,375,245.67
PubMed Score 46.90
PubTator Score 16.75

Knowledge Summary

Patent (5,312)

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -2.903 0.001
adrenocortical carcinoma -1.217 0.000
non-small cell lung cancer -1.813 0.000
intraductal papillary-mucinous adenoma (... 2.200 0.013
lung cancer -3.400 0.000
active Crohn's disease 1.597 0.003
ulcerative colitis 2.400 0.000
pancreatic cancer 1.500 0.000
interstitial cystitis -2.200 0.000
lung adenocarcinoma -1.400 0.000
atypical teratoid/rhabdoid tumor 1.100 0.050
group 3 medulloblastoma -1.100 0.033
spina bifida -2.286 0.036
acute myeloid leukemia -2.300 0.036
ovarian cancer -3.300 0.000

Gene RIF (16)

PMID Text
26004201 Mutations of GPR126 are responsible for severe arthrogryposis multiplex congenita.
25954032 Together, these data uncover Gpr126 as a genetic cause for the pathogenesis of Adolescent idiopathic scoliosis (AIS) and pectus excavatum in a mouse model.
25479386 Genetic variants of GPR126 gene are associated with adolescent idiopathic scoliosis susceptibility in Chinese populations.
25217645 GPR126 modulates both physiological and pathological angiogenesis through VEGF signaling
24227709 Gpr126 functions in Schwann cells for proper development and myelination through G-protein-signaling pathways.
23666238 A single nucleotide polymorphism in the GPR126 gene is associated with increased susceptibility for adolescent idiopathic scoliosis. [Meta-analysis]
21929287 Possible new targets for GPCR modulation: allosteric interactions, plasma membrane domains, intercellular transfer and epigenetic mechanisms.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20397748 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDYPNSQACMWT      1 - 70
LRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKK     71 - 140
GFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFT    141 - 210
QLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDST    211 - 280
ISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKA    281 - 350
ESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN    351 - 420
ILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWALLVYNATNNT    421 - 490
NLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRIC    491 - 560
FYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQNLTSANITNIVEQVKRIVNKEENIDITLGST    561 - 630
LMNIFSNILSSSDSDLLESSSEALKTIDELAFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGL    631 - 700
PSNNESYFQMDFESGQVDPLASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVM    701 - 770
ACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF    771 - 840
THFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLF    841 - 910
LNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWG    911 - 980
LPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGR    981 - 1050
NGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKEN   1051 - 1120
VQKQWRQHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSH   1121 - 1190
TDNVSYEHSFNKSGSLRQCFHGQVLVKTGPC                                          1191 - 1221
//

Text Mined References (40)

PMID Year Title
26004201 2015 Mutations of GPR126 are responsible for severe arthrogryposis multiplex congenita.
25954032 2015 Gpr126/Adgrg6 deletion in cartilage models idiopathic scoliosis and pectus excavatum in mice.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25479386 2015 Association of GPR126 gene polymorphism with adolescent idiopathic scoliosis in Chinese populations.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25217645 2014 GPR126 protein regulates developmental and pathological angiogenesis through modulation of VEGFR2 receptor signaling.
25118328 2014 Type IV collagen is an activating ligand for the adhesion G protein-coupled receptor GPR126.
24227709 2013 Gpr126 functions in Schwann cells to control differentiation and myelination via G-protein activation.
23666238 2013 Genetic variants in GPR126 are associated with adolescent idiopathic scoliosis.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
More...