Property Summary

NCBI Gene PubMed Count 37
PubMed Score 55.09
PubTator Score 16.75

Knowledge Summary

Patent (5,312)

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.597 2.5e-03
active ulcerative colitis 1.983 3.7e-03
acute myeloid leukemia -2.300 3.6e-02
adrenocortical carcinoma -1.217 8.9e-07
atypical teratoid/rhabdoid tumor 1.100 5.0e-02
group 3 medulloblastoma -1.100 3.3e-02
interstitial cystitis -1.400 4.3e-03
intraductal papillary-mucinous adenoma (... 2.200 1.3e-02
lung adenocarcinoma -1.400 5.4e-13
lung cancer -2.500 7.3e-04
non-small cell lung cancer -1.813 8.6e-11
osteosarcoma -2.903 7.6e-04
ovarian cancer -3.300 2.8e-05
pancreatic cancer 1.500 4.2e-04
spina bifida -2.286 3.6e-02

Gene RIF (17)

AA Sequence

MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDYPNSQACMWT      1 - 70
LRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKK     71 - 140
GFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFT    141 - 210
QLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDST    211 - 280
ISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKA    281 - 350
ESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN    351 - 420
ILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWALLVYNATNNT    421 - 490
NLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRIC    491 - 560
FYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQNLTSANITNIVEQVKRIVNKEENIDITLGST    561 - 630
LMNIFSNILSSSDSDLLESSSEALKTIDELAFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGL    631 - 700
PSNNESYFQMDFESGQVDPLASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVM    701 - 770
ACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF    771 - 840
THFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLF    841 - 910
LNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWG    911 - 980
LPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGR    981 - 1050
NGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKEN   1051 - 1120
VQKQWRQHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSH   1121 - 1190
TDNVSYEHSFNKSGSLRQCFHGQVLVKTGPC                                          1191 - 1221
//

Text Mined References (42)

PMID Year Title