Property Summary

NCBI Gene PubMed Count 7
PubMed Score 16.86
PubTator Score 1.00

Knowledge Summary

Patent (1,700)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.80834477136624E-9
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Disease Target Count Z-score Confidence
Intestinal schistosomiasis 2 3.438 1.7
Ileitis 6 3.148 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Synonym

Accession Q86SM8 Q2M1V7
Symbols MGRF
MRGE
GPR167

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Opossum OMA EggNOG Inparanoid

  TechDev Info (1)

AA Sequence

MMEPREAGQHVGAANGAQEDVAFNLIILSLTEGLGLGGLLGNGAVLWLLSSNVYRNPFAIYLLDVACADL      1 - 70
IFLGCHMVAIVPDLLQGRLDFPGFVQTSLATLRFFCYIVGLSLLAAVSVEQCLAALFPAWYSCRRPRHLT     71 - 140
TCVCALTWALCLLLHLLLSGACTQFFGEPSRHLCRTLWLVAAVLLALLCCTMCGASLMLLLRVERGPQRP    141 - 210
PPRGFPGLILLTVLLFLFCGLPFGIYWLSRNLLWYIPHYFYHFSFLMAAVHCAAKPVVYFCLGSAQGRRL    211 - 280
PLRLVLQRALGDEAELGAVRETSRRGLVDIAA                                          281 - 312
//

Text Mined References (7)

PMID Year Title
24583173 2014 Comparative genomic analysis of eutherian Mas-related G protein-coupled receptor genes.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.