Property Summary

NCBI Gene PubMed Count 7
PubMed Score 16.86
PubTator Score 1.00

Knowledge Summary

Patent (1,700)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

AA Sequence

MMEPREAGQHVGAANGAQEDVAFNLIILSLTEGLGLGGLLGNGAVLWLLSSNVYRNPFAIYLLDVACADL      1 - 70
IFLGCHMVAIVPDLLQGRLDFPGFVQTSLATLRFFCYIVGLSLLAAVSVEQCLAALFPAWYSCRRPRHLT     71 - 140
TCVCALTWALCLLLHLLLSGACTQFFGEPSRHLCRTLWLVAAVLLALLCCTMCGASLMLLLRVERGPQRP    141 - 210
PPRGFPGLILLTVLLFLFCGLPFGIYWLSRNLLWYIPHYFYHFSFLMAAVHCAAKPVVYFCLGSAQGRRL    211 - 280
PLRLVLQRALGDEAELGAVRETSRRGLVDIAA                                          281 - 312
//

Text Mined References (7)

PMID Year Title
24583173 2014 Comparative genomic analysis of eutherian Mas-related G protein-coupled receptor genes.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.