Property Summary

NCBI Gene PubMed Count 7
PubMed Score 19.43
PubTator Score 1.00

Knowledge Summary

Patent (1,700)

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 2.8e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.4
Disease Target Count Z-score Confidence
Intestinal schistosomiasis 2 3.365 1.7
Ileitis 5 3.081 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 2.8e-09

AA Sequence

MMEPREAGQHVGAANGAQEDVAFNLIILSLTEGLGLGGLLGNGAVLWLLSSNVYRNPFAIYLLDVACADL      1 - 70
IFLGCHMVAIVPDLLQGRLDFPGFVQTSLATLRFFCYIVGLSLLAAVSVEQCLAALFPAWYSCRRPRHLT     71 - 140
TCVCALTWALCLLLHLLLSGACTQFFGEPSRHLCRTLWLVAAVLLALLCCTMCGASLMLLLRVERGPQRP    141 - 210
PPRGFPGLILLTVLLFLFCGLPFGIYWLSRNLLWYIPHYFYHFSFLMAAVHCAAKPVVYFCLGSAQGRRL    211 - 280
PLRLVLQRALGDEAELGAVRETSRRGLVDIAA                                          281 - 312
//

Text Mined References (7)

PMID Year Title