Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.46
PubTator Score 0.13

Knowledge Summary

Patent (293)

AA Sequence

MFGLFGLWRTFDSVVFYLTLIVGLGGPVGNGLVLWNLGFRIKKGPFSIYLLHLAAADFLFLSCRVGFSVA      1 - 70
QAALGAQDTLYFVLTFLWFAVGLWLLAAFSVERCLSDLFPACYQGCRPRHASAVLCALVWTPTLPAVPLP     71 - 140
ANACGLLRNSACPLVCPRYHVASVTWFLVLARVAWTAGVVLFVWVTCCSTRPRPRLYGIVLGALLLLFFC    141 - 210
GLPSVFYWSLQPLLNFLLPVFSPLATLLACVNSSSKPLIYSGLGRQPGKREPLRSVLRRALGEGAELGAR    211 - 280
GQSLPMGLL                                                                 281 - 289
//

Text Mined References (2)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.