Property Summary

NCBI Gene PubMed Count 15
Grant Count 85
R01 Count 34
Funding $11,208,552.57
PubMed Score 276.26
PubTator Score 86.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86SK9 B2RPG0 Q4W5Q5 Q8NDS0 Q9H7D1
Symbols SCD2
SCD4
ACOD4
FADS4
HSCD5

Gene

Gene RIF (10)

PMID Text
25802234 SCD5 appears to functionally connect tumour cells and the surrounding stroma toward modification of the tumour microenvironment, with consequences on tumour spread and resistance to treatment.
23867797 The protective effect of TO901317 was lost after gene silencing of Scd-1/-2, thereby confirming that the protective effect of TO901317 is mediated by Scd-1/-2.
22745828 Data suggest that, by a coordinated modulation of key lipogenic pathways and transduction signaling cascades, SCD5 participates in the regulation of neuronal cell growth and differentiation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17468887 In this paper, we describe for the first time a second SCD isoform in cattle, which appears to be an ortholog of human SCD5 rather than a homolog of bovine SCD1 or any of the described murine SCD isoforms
15610069 The identification and characterization of SCD2, and its relationship to human SCD1 and mouse SCD2, are reported.
12815040 SCD4 demonstrates tissue-specific regulation by leptin and dietary factors

AA Sequence

MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKA      1 - 70
KPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFEWSRDHRAHHKYSET     71 - 140
DADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRKYYKISVVLMCFVVPTLVPWY    141 - 210
IWGESLWNSYFLASILRYTISLNISWLVNSAAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPF    211 - 280
DYSASEFGLNFNPTTWFIDFMCWLGLATDRKRATKPMIEARKARTGDSSA                        281 - 330
//

Text Mined References (20)

PMID Year Title
25802234 2015 SCD5-induced oleic acid production reduces melanoma malignancy by intracellular retention of SPARC and cathepsin B.
23867797 2013 Susceptibility of podocytes to palmitic acid is regulated by stearoyl-CoA desaturases 1 and 2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22745828 2012 StearoylCoA desaturase-5: a novel regulator of neuronal cell proliferation and differentiation.
22046234 2011 Elevated stearoyl-CoA desaturase in brains of patients with Alzheimer's disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...