Property Summary

Ligand Count 3
NCBI Gene PubMed Count 15
PubMed Score 298.61
PubTator Score 86.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma 1.400 8.2e-03
aldosterone-producing adenoma -1.047 4.6e-02
Alzheimer's disease -1.200 2.6e-02
astrocytic glioma 1.200 1.8e-03
Astrocytoma, Pilocytic 1.500 8.6e-04
atypical teratoid / rhabdoid tumor -2.700 1.0e-04
Breast cancer -2.400 2.1e-07
cystic fibrosis 2.038 5.1e-07
glioblastoma 1.600 2.1e-03
group 4 medulloblastoma -1.700 4.8e-05
intraductal papillary-mucinous adenoma (... -3.000 1.2e-03
intraductal papillary-mucinous carcinoma... -3.800 1.9e-04
intraductal papillary-mucinous neoplasm ... -2.300 3.6e-02
lung adenocarcinoma -1.100 5.5e-14
medulloblastoma, large-cell -2.200 4.2e-06
Multiple myeloma -1.792 7.8e-04
nasopharyngeal carcinoma 1.300 7.9e-03
oligodendroglioma 1.200 3.0e-03
osteosarcoma 1.702 1.7e-03
ovarian cancer -2.800 9.1e-06
pancreatic cancer -1.100 2.2e-03
Pick disease -1.600 1.3e-04
posterior fossa group A ependymoma -1.100 4.8e-05
progressive supranuclear palsy -1.100 2.0e-02
psoriasis -1.500 8.0e-36
subependymal giant cell astrocytoma -2.588 1.1e-03
tuberculosis 1.300 2.1e-03
Waldenstrons macroglobulinemia -1.546 1.6e-02

Gene RIF (10)

AA Sequence

MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKA      1 - 70
KPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFEWSRDHRAHHKYSET     71 - 140
DADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRKYYKISVVLMCFVVPTLVPWY    141 - 210
IWGESLWNSYFLASILRYTISLNISWLVNSAAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPF    211 - 280
DYSASEFGLNFNPTTWFIDFMCWLGLATDRKRATKPMIEARKARTGDSSA                        281 - 330
//

Text Mined References (20)

PMID Year Title